JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177623

Recombinant Human Haptoglobin protein - BSA and Azide free (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Haptoglobin protein - BSA and Azide free (denatured) (His tag N-Terminus) is a Human Fragment protein, in the 19 to 347 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE.

View Alternative Names

Haptoglobin, Zonulin, HP

1 Images
SDS-PAGE - Recombinant Human Haptoglobin protein - BSA and Azide free (denatured) (His tag N-Terminus) (AB177623)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Haptoglobin protein - BSA and Azide free (denatured) (His tag N-Terminus) (AB177623)

15% SDS-PAGE analysis of ab177623 (3ug)

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P00738

Animal free

No

Carrier free

Yes

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN","proteinLength":"Fragment","predictedMolecularWeight":"45 kDa","actualMolecularWeight":null,"aminoAcidEnd":347,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P00738","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Haptoglobin (Hp) also known as Hp protein is a glycoprotein with a molecular weight ranging from 85 to 100 kDa varying due to its ability to form different dimeric and multimeric structures. It is primarily synthesized in the liver and circulating in the plasma. Mechanically haptoglobin binds free hemoglobin released from erythrocytes preventing oxidative damage and hemoglobin-driven deleterious effects. Haptoglobin's binding to hemoglobin forms a haptoglobin-hemoglobin complex that gets cleared by the CD163 receptor on macrophages mainly in the liver and spleen.
Biological function summary

Haptoglobin functions as an antioxidant and an acute phase protein playing roles in inflammation and immune response. It is an essential component of the antioxidant defense system reducing oxidative stress by binding free hemoglobin. Additionally haptoglobin can participate in complex formation with hemoglobin to facilitate the clearance of excess free hemoglobin from circulation. Its expression increases during inflammation under the regulation of cytokines like IL-6.

Pathways

The haptoglobin protein is part of the hemoglobin clearance pathway integral for iron metabolism and homeostasis. This pathway ensures the safe removal of hemoglobin from the blood helping to prevent kidney damage. Haptoglobin is related to other proteins such as CD163 and the liver-derived hepatocellular proteins involved in the clearance process. Also haptoglobin is linked to antioxidant pathways collaborating with oxidative stress regulators to manage reactive oxygen species levels.

Changes in haptoglobin levels are associated with hemolytic anemia and inflammatory conditions. Low haptoglobin levels often suggest hemolytic anemia due to its rapid binding with free hemoglobin in the bloodstream. During inflammation and infections 'anti-Hp' tests (haptoglobin tests) may show increased haptoglobin levels as a response to cytokine signaling. Moreover haptoglobin polymorphisms have a connection with ischemic stroke susceptibility where its isoforms show differing efficiencies in binding free hemoglobin. These findings highlight haptoglobin's relevance as a biomarker for these conditions and illustrate its interaction with hematologic and immune proteins in disease contexts.

Specifications

Form

Liquid

General info

Function

As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity, and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.. The uncleaved form of allele alpha-2 (2-2), known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.

Sequence similarities

Belongs to the peptidase S1 family.

Product protocols

Target data

As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity, and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.. The uncleaved form of allele alpha-2 (2-2), known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.
See full target information HP

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com