JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB239558

Recombinant Human HAUSP / USP7 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human HAUSP / USP7 protein (Tagged) is a Human Fragment protein, in the 214 to 521 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

HAUSP, USP7, Ubiquitin carboxyl-terminal hydrolase 7, Deubiquitinating enzyme 7, Herpesvirus-associated ubiquitin-specific protease, Ubiquitin thioesterase 7, Ubiquitin-specific-processing protease 7

1 Images
SDS-PAGE - Recombinant Human HAUSP / USP7 protein (Tagged) (AB239558)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human HAUSP / USP7 protein (Tagged) (AB239558)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab239558.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

10x His tag N-Terminus SUMO tag N-Terminus Myc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q93009

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"VGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRE","proteinLength":"Fragment","predictedMolecularWeight":"55.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":521,"aminoAcidStart":214,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q93009","tags":[{"tag":"10x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"},{"tag":"Myc","terminus":"C-Terminus"}]}]

Properties and storage information

Form
Liquid
Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

HAUSP also known as USP7 is a deubiquitinating enzyme with a molecular mass of approximately 135 kDa. It functions by removing ubiquitin molecules from target proteins influencing their stability and activity. HAUSP is widely expressed in various human tissues with notable presence in the nucleus and cytoplasm. Its expression is essential for modulation of multiple signaling pathways. The enzyme's capacity to regulate protein ubiquitination dynamics makes it a significant player in cellular function.
Biological function summary

HAUSP influences several critical cellular processes including DNA repair transcriptional regulation and cell cycle progression. It often interacts with other proteins such as p53 to modify their functions by altering their ubiquitination status. HAUSP does not function in isolation but forms part of larger protein complexes where it plays a role in processing substrate proteins. Its ability to activate or deactivate proteins through deubiquitination highlights its importance in maintaining cellular homeostasis.

Pathways

Research identifies HAUSP as an important component in both the p53 pathway and the Wnt signaling pathway. Through the p53 pathway HAUSP directly interacts with the p53 tumor suppressor protein influencing cell cycle and apoptosis decisions. Its participation in the Wnt signaling pathway associates it with beta-catenin where it supports cellular proliferation and differentiation. These pathway interactions illustrate HAUSP's integral role in maintaining cellular function and responding to various signaling inputs.

HAUSP has implications in cancer and neurodegenerative diseases. Aberrant activity or expression of HAUSP has been linked to tumorigenesis particularly through its interaction with the proteins p53 and MDM2 affecting cell survival and proliferation. In neurodegenerative conditions altered HAUSP activity may impact protein homeostasis and degradation pathways contributing to disease progression. Its connection to these proteins and disease states highlights its potential as a therapeutic target in associated disorders.

General info

Function

Hydrolase that deubiquitinates target proteins such as ARMC5, FOXO4, DEPTOR, KAT5, p53/TP53, MDM2, ERCC6, DNMT1, UHRF1, PTEN, KMT2E/MLL5 and DAXX (PubMed : 11923872, PubMed : 15053880, PubMed : 16964248, PubMed : 18716620, PubMed : 25283148, PubMed : 25865756, PubMed : 26678539, PubMed : 28655758, PubMed : 33544460, PubMed : 35216969). Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation (PubMed : 15053880, PubMed : 16845383, PubMed : 18566590, PubMed : 20153724). Deubiquitinates p53/TP53, preventing degradation of p53/TP53, and enhances p53/TP53-dependent transcription regulation, cell growth repression and apoptosis (PubMed : 25283148). Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis (PubMed : 11923872, PubMed : 26786098). Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity (PubMed : 16964248). In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML (PubMed : 18716620). Deubiquitinates KMT2E/MLL5 preventing KMT2E/MLL5 proteasomal-mediated degradation (PubMed : 26678539). Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage : recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6 (PubMed : 22466611, PubMed : 22466612). Involved in maintenance of DNA methylation via its interaction with UHRF1 and DNMT1 : acts by mediating deubiquitination of UHRF1 and DNMT1, preventing their degradation and promoting DNA methylation by DNMT1 (PubMed : 21745816, PubMed : 22411829). Deubiquitinates alkylation repair enzyme ALKBH3. OTUD4 recruits USP7 and USP9X to stabilize ALKBH3, thereby promoting the repair of alkylated DNA lesions (PubMed : 25944111). Acts as a chromatin regulator via its association with the Polycomb group (PcG) multiprotein PRC1-like complex; may act by deubiquitinating components of the PRC1-like complex (PubMed : 20601937). Able to mediate deubiquitination of histone H2B; it is however unsure whether this activity takes place in vivo (PubMed : 20601937). Exhibits a preference towards 'Lys-48'-linked ubiquitin chains (PubMed : 22689415). Increases regulatory T-cells (Treg) suppressive capacity by deubiquitinating and stabilizing the transcription factor FOXP3 which is crucial for Treg cell function (PubMed : 23973222). Plays a role in the maintenance of the circadian clock periodicity via deubiquitination and stabilization of the CRY1 and CRY2 proteins (PubMed : 27123980). Deubiquitinates REST, thereby stabilizing REST and promoting the maintenance of neural progenitor cells (PubMed : 21258371). Deubiquitinates SIRT7, inhibiting SIRT7 histone deacetylase activity and regulating gluconeogenesis (PubMed : 28655758). Involved in the regulation of WASH-dependent actin polymerization at the surface of endosomes and the regulation of endosomal protein recycling (PubMed : 26365382). It maintains optimal WASH complex activity and precise F-actin levels via deubiquitination of TRIM27 and WASHC1 (PubMed : 26365382). Mediates the deubiquitination of phosphorylated DEPTOR, promoting its stability and leading to decreased mTORC1 signaling (PubMed : 35216969).. (Microbial infection) Contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection.. (Microbial infection) Upon infection with Epstein-Barr virus, the interaction with viral EBNA1 increases the association of USP7 with PML proteins, which is required for the polyubiquitylation and degradation of PML.

Sequence similarities

Belongs to the peptidase C19 family.

Post-translational modifications

Isoform 1: Phosphorylated. Isoform 1 is phosphorylated at positions Ser-18 and Ser-963. Isoform 2: Not phosphorylated.. Isoform 1: Polyneddylated. Isoform 2: Not Polyneddylated.. Isoform 1 and isoform 2: Not sumoylated.. Isoform 1 and isoform 2: Polyubiquitinated by herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110; leading to its subsequent proteasomal degradation. Isoform 1: Ubiquitinated at Lys-869.

Product protocols

Target data

Hydrolase that deubiquitinates target proteins such as ARMC5, FOXO4, DEPTOR, KAT5, p53/TP53, MDM2, ERCC6, DNMT1, UHRF1, PTEN, KMT2E/MLL5 and DAXX (PubMed : 11923872, PubMed : 15053880, PubMed : 16964248, PubMed : 18716620, PubMed : 25283148, PubMed : 25865756, PubMed : 26678539, PubMed : 28655758, PubMed : 33544460, PubMed : 35216969). Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation (PubMed : 15053880, PubMed : 16845383, PubMed : 18566590, PubMed : 20153724). Deubiquitinates p53/TP53, preventing degradation of p53/TP53, and enhances p53/TP53-dependent transcription regulation, cell growth repression and apoptosis (PubMed : 25283148). Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis (PubMed : 11923872, PubMed : 26786098). Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity (PubMed : 16964248). In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML (PubMed : 18716620). Deubiquitinates KMT2E/MLL5 preventing KMT2E/MLL5 proteasomal-mediated degradation (PubMed : 26678539). Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage : recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6 (PubMed : 22466611, PubMed : 22466612). Involved in maintenance of DNA methylation via its interaction with UHRF1 and DNMT1 : acts by mediating deubiquitination of UHRF1 and DNMT1, preventing their degradation and promoting DNA methylation by DNMT1 (PubMed : 21745816, PubMed : 22411829). Deubiquitinates alkylation repair enzyme ALKBH3. OTUD4 recruits USP7 and USP9X to stabilize ALKBH3, thereby promoting the repair of alkylated DNA lesions (PubMed : 25944111). Acts as a chromatin regulator via its association with the Polycomb group (PcG) multiprotein PRC1-like complex; may act by deubiquitinating components of the PRC1-like complex (PubMed : 20601937). Able to mediate deubiquitination of histone H2B; it is however unsure whether this activity takes place in vivo (PubMed : 20601937). Exhibits a preference towards 'Lys-48'-linked ubiquitin chains (PubMed : 22689415). Increases regulatory T-cells (Treg) suppressive capacity by deubiquitinating and stabilizing the transcription factor FOXP3 which is crucial for Treg cell function (PubMed : 23973222). Plays a role in the maintenance of the circadian clock periodicity via deubiquitination and stabilization of the CRY1 and CRY2 proteins (PubMed : 27123980). Deubiquitinates REST, thereby stabilizing REST and promoting the maintenance of neural progenitor cells (PubMed : 21258371). Deubiquitinates SIRT7, inhibiting SIRT7 histone deacetylase activity and regulating gluconeogenesis (PubMed : 28655758). Involved in the regulation of WASH-dependent actin polymerization at the surface of endosomes and the regulation of endosomal protein recycling (PubMed : 26365382). It maintains optimal WASH complex activity and precise F-actin levels via deubiquitination of TRIM27 and WASHC1 (PubMed : 26365382). Mediates the deubiquitination of phosphorylated DEPTOR, promoting its stability and leading to decreased mTORC1 signaling (PubMed : 35216969).. (Microbial infection) Contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection.. (Microbial infection) Upon infection with Epstein-Barr virus, the interaction with viral EBNA1 increases the association of USP7 with PML proteins, which is required for the polyubiquitylation and degradation of PML.
See full target information USP7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com