JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB229357

Recombinant Human HCST protein (Fc tag C-Terminus + His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human HCST protein (Fc tag C-Terminus + His tag C-Terminus) is a Human Fragment protein, in the 20 to 48 aa range, expressed in Baculovirus infected insect cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

DAP10, KAP10, PIK3AP, UNQ587/PRO1157, HCST, Hematopoietic cell signal transducer, DNAX-activation protein 10, Membrane protein DAP10, Transmembrane adapter protein KAP10

1 Images
SDS-PAGE - Recombinant Human HCST protein (Fc tag C-Terminus + His tag C-Terminus) (AB229357)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human HCST protein (Fc tag C-Terminus + His tag C-Terminus) (AB229357)

15% SDS-PAGE analysis of 3 μg ab229357.

MW : 28-40 kDa (SDS-PAGE under reducing conditions).

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected insect cells

Tags

Fc tag C-Terminus His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9UBK5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ADPTTPGERSSLPAFYPGTSGSCSGCGSLSLPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"30.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":48,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"Q9UBK5","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

HCST also known as Hematopoietic Cell Signal Transducer or DNAX-activation protein 10 (DAP10) is an adaptor protein with a mass of approximately 10 kDa. It mainly expresses in hematopoietic cells specifically in natural killer (NK) cells and some T cell subsets. This protein lacks enzymatic activity but plays a significant role in transducing signals within immune cells. Its structure includes a tyrosine-based motif that facilitates its interaction with receptors on the cell surface enabling it to act as a bridge for signal transduction.
Biological function summary

HCST contributes to the activation and proliferation of NK and T cells. It operates as part of a protein complex with the receptor NKG2D. This interaction results in the promotion of immune responses necessary for targeting and destroying infected or cancerous cells. HCST's role in immune signaling highlights its importance in maintaining the body's defense mechanisms ensuring effective immune surveillance and response.

Pathways

HCST plays a significant role in the NKG2D-mediated signaling pathway. This pathway is vital for the cytotoxic function of NK cells allowing them to identify and eliminate cells that display stress-induced ligands. Besides its association with NKG2D HCST helps regulate pathways involving the PI3K-Akt signaling often activated in immune responses and cellular survival mechanisms. In this context it interacts with proteins like DAP12 which also facilitate NK cell activation and cytokine production.

HCST shows connections with cancer and autoimmune diseases. This protein's involvement in NK cell activation links it to cancer immunity where alterations in its function may lead to inadequate immune responses against tumors. Furthermore in autoimmune diseases HCST's dysregulation can contribute to inappropriate immune activation potentially exacerbating inflammation. HCST's role in these conditions involves its interactions with proteins like NKG2D and DAP12 highlighting its critical position in immune modulation.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Transmembrane adapter protein which associates with KLRK1 to form an activation receptor KLRK1-HCST in lymphoid and myeloid cells; this receptor plays a major role in triggering cytotoxicity against target cells expressing cell surface ligands such as MHC class I chain-related MICA and MICB, and UL16-binding proteins (ULBPs); these ligands are up-regulated by stress conditions and pathological state such as viral infection and tumor transformation. Functions as a docking site for PI3-kinase PIK3R1 and GRB2. Interaction of ULBPs with KLRK1-HCST triggers calcium mobilization and activation of the PIK3R1, MAP2K/ERK, and JAK2/STAT5 signaling pathways. Both PIK3R1 and GRB2 are required for full KLRK1-HCST-mediated activation and ultimate killing of target cells. In NK cells, KLRK1-HCST signaling directly induces cytotoxicity and enhances cytokine production initiated via DAP12/TYROBP-associated receptors. In T-cells, it provides primarily costimulation for TCR-induced signals. KLRK1-HCST receptor plays a role in immune surveillance against tumors and is required for cytolysis of tumors cells; indeed, melanoma cells that do not express KLRK1 ligands escape from immune surveillance mediated by NK cells.

Sequence similarities

Belongs to the DAP10 family.

Post-translational modifications

Phosphorylated; PIK3R1 and GRB2 associate specifically with tyrosine-phosphorylated HCST.. O-glycosylated.

Product protocols

Target data

Transmembrane adapter protein which associates with KLRK1 to form an activation receptor KLRK1-HCST in lymphoid and myeloid cells; this receptor plays a major role in triggering cytotoxicity against target cells expressing cell surface ligands such as MHC class I chain-related MICA and MICB, and UL16-binding proteins (ULBPs); these ligands are up-regulated by stress conditions and pathological state such as viral infection and tumor transformation. Functions as a docking site for PI3-kinase PIK3R1 and GRB2. Interaction of ULBPs with KLRK1-HCST triggers calcium mobilization and activation of the PIK3R1, MAP2K/ERK, and JAK2/STAT5 signaling pathways. Both PIK3R1 and GRB2 are required for full KLRK1-HCST-mediated activation and ultimate killing of target cells. In NK cells, KLRK1-HCST signaling directly induces cytotoxicity and enhances cytokine production initiated via DAP12/TYROBP-associated receptors. In T-cells, it provides primarily costimulation for TCR-induced signals. KLRK1-HCST receptor plays a role in immune surveillance against tumors and is required for cytolysis of tumors cells; indeed, melanoma cells that do not express KLRK1 ligands escape from immune surveillance mediated by NK cells.
See full target information HCST

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com