JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB226403

Recombinant Human HDAC6 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human HDAC6 protein (Tagged) is a Human Fragment protein, in the 1 to 488 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

KIAA0901, JM21, HDAC6, Histone deacetylase 6, HD6, Protein deacetylase HDAC6, Tubulin-lysine deacetylase HDAC6

1 Images
SDS-PAGE - Recombinant Human HDAC6 protein (Tagged) (AB226403)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human HDAC6 protein (Tagged) (AB226403)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226403 with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9UBN7

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN","proteinLength":"Fragment","predictedMolecularWeight":"70.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":488,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UBN7","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

HDAC6 or histone deacetylase 6 is a protein that primarily functions as a cytoplasmic deacetylase. It is part of the class IIb HDAC family and is known for its distinctive molecular weight of approximately 121 kDa. HDAC6 is expressed in various tissues with higher levels observed in the brain kidney and liver. This protein is unique as it contains two catalytic domains unlike other HDACs which contributes to its specific deacetylation of non-histone substrates including tubulin and Hsp90 influencing cell motility and stress response.
Biological function summary

HDAC6 plays a significant role in processes like protein degradation and cell signaling. It is an important component of the protein quality control system involving itself in the aggresome pathway where it facilitates the removal of misfolded proteins through interaction with dynein motor proteins. In addition to its presence in the cytoplasm HDAC6 influences cell migration and immune response regulation by de-phosphorylating cortactin and affecting actin filament dynamics. Its integral role in the aggresome-autophagy pathway positions it as important for cellular homeostasis maintenance.

Pathways

HDAC6 participates prominently in both autophagy and stress response pathways. In the autophagic process HDAC6 operates alongside ubiquitinated proteins to manage protein quality control. Moreover HDAC6 engages in stress response pathways like the heat shock response interacting directly with Hsp90 to regulate client protein activation. These pathways highlight HDAC6’s relationships with key proteins such as Hsp70 and tau linking it to cellular stress and neurodegeneration responses.

HDAC6 exhibits connections to neurodegenerative diseases and cancer. Dysregulated HDAC6 activity associates with Alzheimer's disease where it affects tau protein accumulation and degradation. The protein is also implicated in various cancers such as breast and ovarian cancer due to its influence on cell migration and invasion. It interacts with p53 impacting apoptosis and tumor progression making HDAC6 a potential target for therapeutic interventions with HDAC6 inhibitors which aim to restore normal cellular functions disrupted by abnormal HDAC6 activity.

Specifications

Form

Liquid

General info

Function

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) (PubMed : 10220385). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events (PubMed : 10220385). Histone deacetylases act via the formation of large multiprotein complexes (PubMed : 10220385). In addition to histones, deacetylates other proteins, such as CTTN, tubulin and SQSTM1 (PubMed : 12024216, PubMed : 20308065, PubMed : 26246421, PubMed : 30538141, PubMed : 31857589). Plays a central role in microtubule-dependent cell motility by mediating deacetylation of tubulin (PubMed : 12024216, PubMed : 20308065, PubMed : 26246421). Required for cilia disassembly; via deacetylation of alpha-tubulin (PubMed : 17604723, PubMed : 26246421). Promotes deacetylation of CTTN, leading to actin polymerization, promotion of autophagosome-lysosome fusion and completion of autophagy (PubMed : 30538141). Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer (PubMed : 24413532). Promotes odontoblast differentiation following IPO7-mediated nuclear import and subsequent repression of RUNX2 expression (By similarity). In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins : when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome (PubMed : 17846173). Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy (PubMed : 17846173).

Sequence similarities

Belongs to the histone deacetylase family. HD type 2 subfamily.

Post-translational modifications

Phosphorylated by AURKA; phosphorylation increases HDAC6-mediated deacetylation of alpha-tubulin and subsequent disassembly of cilia.. Ubiquitinated. Its polyubiquitination however does not lead to its degradation.. Sumoylated in vitro.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) (PubMed : 10220385). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events (PubMed : 10220385). Histone deacetylases act via the formation of large multiprotein complexes (PubMed : 10220385). In addition to histones, deacetylates other proteins, such as CTTN, tubulin and SQSTM1 (PubMed : 12024216, PubMed : 20308065, PubMed : 26246421, PubMed : 30538141, PubMed : 31857589). Plays a central role in microtubule-dependent cell motility by mediating deacetylation of tubulin (PubMed : 12024216, PubMed : 20308065, PubMed : 26246421). Required for cilia disassembly; via deacetylation of alpha-tubulin (PubMed : 17604723, PubMed : 26246421). Promotes deacetylation of CTTN, leading to actin polymerization, promotion of autophagosome-lysosome fusion and completion of autophagy (PubMed : 30538141). Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer (PubMed : 24413532). Promotes odontoblast differentiation following IPO7-mediated nuclear import and subsequent repression of RUNX2 expression (By similarity). In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins : when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome (PubMed : 17846173). Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy (PubMed : 17846173).
See full target information HDAC6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com