JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB131697

Recombinant Human Hemoglobin subunit alpha protein (denatured)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Hemoglobin subunit alpha protein (denatured) is a Human Full Length protein, in the 1 to 142 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

HBA2, HBA1, Hemoglobin subunit alpha, Alpha-globin, Hemoglobin alpha chain

3 Images
Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (AB131697)
  • WB

Lab

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (AB131697)

**Blocking/Dilution buffer : ** 5% NFDM/TBST.

All lanes:

Western blot - Anti-Hemoglobin subunit beta antibody [EPR20614] (<a href='/en-us/products/primary-antibodies/hemoglobin-subunit-beta-antibody-epr20614-ab214049'>ab214049</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (ab131697) at 0.01 µg

Lane 2:

His-tagged human Hemoglobin subunit beta/ba1 (aa3-147) recombinant protein at 0.01 µg

Lane 3:

His-tagged human Hemoglobin subunit delta (aa3-147) recombinant protein at 0.01 µg

Lane 4:

His-tagged human Hemoglobin subunit epsilon (aa3-147) recombinant protein at 0.01 µg

Lane 5:

His-tagged human Hemoglobin subunit Gamma-2 (aa2-147) recombinant protein at 0.01 µg

Lane 6:

His-tagged human Hemoglobin subunit Gamma-1 (aa2-147) recombinant protein at 0.01 µg

Lane 7:

Western blot - Recombinant Human Hemoglobin subunit zeta protein (<a href='/en-us/products/proteins-peptides/recombinant-human-hemoglobin-subunit-zeta-protein-ab95347'>ab95347</a>) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 16 kDa

Observed band size: 15 kDa

true

Exposure time: 3s

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (AB131697)
  • WB

Supplier Data

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (AB131697)

Blocking/Dilutiing buffer and concentration : 5% NFDM/TBST Exposure time : 100 seconds

All lanes:

Western blot - Anti-Hemoglobin subunit beta + Hemoglobin subunit delta antibody [EPR8322(B)] (<a href='/en-us/products/primary-antibodies/hemoglobin-subunit-beta-hemoglobin-subunit-delta-antibody-epr8322b-ab131225'>ab131225</a>) at 1/200 dilution

Lane 1:

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (ab131697) at 0.1 µg

Lane 2:

His-tagged human Hemoglobin subunit beta/ba1 (aa 3-147) recombinant protein at 0.1 µg

Lane 3:

His-tagged human Hemoglobin subunit delta (aa 3-147) recombinant protein at 0.1 µg

Lane 4:

His-tagged full length human Hemoglobin subunit delta recombinant protein at 0.1 µg

Lane 5:

His-tagged human Hemoglobin subunit epsilon (aa 3-147) recombinant protein at 0.1 µg

Lane 6:

His-tagged human Hemoglobin subunit gamma-2 (aa 2-147) recombinant protein at 0.1 µg

Lane 7:

His-tagged human Hemoglobin subunit gamma-1 (aa 2-147) recombinant protein at 0.1 µg

Lane 8:

Western blot - Recombinant Human Hemoglobin subunit zeta protein (<a href='/en-us/products/proteins-peptides/recombinant-human-hemoglobin-subunit-zeta-protein-ab95347'>ab95347</a>) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

false

SDS-PAGE - Recombinant Human Hemoglobin subunit alpha protein (denatured) (AB131697)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Hemoglobin subunit alpha protein (denatured) (AB131697)

SDS-PAGE analysis of ab131697 (3 μg) under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

DDDDK tag N-Terminus His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P69905

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 12.01% Urea, 0.58% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR","proteinLength":"Full Length","predictedMolecularWeight":"19.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":142,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P69905","tags":[{"tag":"DDDDK","terminus":"N-Terminus"},{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Hemoglobin subunit alpha also known as alpha-globin is a component of the hemoglobin protein complex which plays an important role in oxygen transport within the blood. Alpha-globin has an approximate molecular weight of 15.1 kDa and is expressed highly in the red blood cells. It is part of the hemoglobin tetramer along with two beta subunits each one containing an iron-bound heme group. Variants of the alpha chain can be studied using hemoglobin peptides or denatured hemoglobin samples. Researchers can further analyze the alpha hemoglobin using methods like SDS-PAGE or alpha ELISA assays.
Biological function summary

Hemoglobin subunit alpha forms an important part of the hemoglobin complex facilitating the binding and release of oxygen molecules as blood circulates in the body. Alpha hemoglobin ensures efficient loading of oxygen in the lungs and unloading in tissues maintaining cellular respiration. The subunit plays a structural role as well stabilizing the hemoglobin tetramer for optimal function. Its ability to carry oxygen depends on the cooperative interaction between its alpha and beta globin counterparts.

Pathways

Hemoglobin subunit alpha operates predominantly within the oxygen transport pathway which is essential to meet the metabolic demands of cells. It also links to pathways involving iron metabolism given its coordination with heme groups. Alpha hemoglobin interacts cooperatively with proteins such as beta-globin to ensure efficient oxygen delivery. This interplay is highlighted when examining hemoglobin biosynthesis and breakdown pathways.

Alpha-globin is linked to conditions like alpha-thalassemia and sickle cell disease. These disorders result from mutations in the hemoglobin alpha or beta subunits leading to imbalanced globin production or abnormal hemoglobin structures. Alpha thalassemia is connected with unequal production of globin chains affecting hemoglobin stability while beta-globin mutations lead to sickle cell disease with altered oxygen delivery. Anti-hemoglobin antibodies might help in researching these conditions allowing a better understanding of molecular changes and potential therapeutic targets.

Specifications

Form

Liquid

Additional notes

ab131697 was purified using conventional chromatography techniques.

General info

Function

Involved in oxygen transport from the lung to the various peripheral tissues.. Hemopressin. Hemopressin acts as an antagonist peptide of the cannabinoid receptor CNR1 (PubMed : 18077343). Hemopressin-binding efficiently blocks cannabinoid receptor CNR1 and subsequent signaling (PubMed : 18077343).

Sequence similarities

Belongs to the globin family.

Post-translational modifications

The initiator Met is not cleaved in variant Thionville and is acetylated.

Product protocols

Target data

Involved in oxygen transport from the lung to the various peripheral tissues.. Hemopressin. Hemopressin acts as an antagonist peptide of the cannabinoid receptor CNR1 (PubMed : 18077343). Hemopressin-binding efficiently blocks cannabinoid receptor CNR1 and subsequent signaling (PubMed : 18077343).
See full target information HBA1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com