JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158639

Recombinant Human Hemoglobin subunit beta protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Hemoglobin subunit beta protein is a Human Fragment protein, in the 38 to 147 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Hemoglobin subunit beta, Beta-globin, Hemoglobin beta chain, HBB

1 Images
SDS-PAGE - Recombinant Human Hemoglobin subunit beta protein (AB158639)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Hemoglobin subunit beta protein (AB158639)

ab158639 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P68871

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Hemoglobin subunit beta.

Sequence info

[{"sequence":"WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":147,"aminoAcidStart":38,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P68871","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The hemoglobin subunit beta also known as beta hemoglobin or hemoglobin beta subunit is a component of the larger hemoglobin molecule important for transporting oxygen in red blood cells. This protein has a molecular weight of approximately 16 kDa. Hemoglobin subunit beta joins with alpha hemoglobin subunit to form hemoglobin A the most common form in adult humans. Expression of this protein happens in the erythroid cells of the bone marrow where it plays an important role in the production of hemoglobin during red blood cell formation.
Biological function summary

The hemoglobin beta subunit is essential for binding and releasing oxygen to tissues throughout the body. As part of the hemoglobin complex it helps stabilize the oxygen binding affinity through cooperative interactions with the alpha subunits. When oxygen binds to the heme groups in these subunits a conformational change occurs enhancing the efficiency of oxygen transport. This dynamic action allows hemoglobin to carry oxygen from the lungs to tissues and return carbon dioxide for expulsion.

Pathways

Hemoglobin beta subunit significantly participates in the oxygen transport and carbon dioxide exchange pathways. It interacts closely with carbonic anhydrase in the process of carbon dioxide transport converting it to bicarbonate for efficient clearance from the body. In this capacity the protein stands as a central component of the erythrocyte function and blood gas transport system partnering physiologically with proteins such as cytochrome b5 reductase in electron transfer-related pathways.

Hemoglobin subunit beta is prominently associated with hemoglobinopathies like sickle cell disease and beta-thalassemia. Mutations in its gene can lead to abnormal hemoglobin function or structure causing red blood cell disorders that impact oxygen delivery. In sickle cell disease an amino acid substitution causes hemoglobin to polymerize under low oxygen resulting in sickle-shaped cells. In beta-thalassemia reduced or absent beta-globin chain production leads to anemia. These hemoglobin-related disorders are tightly connected to genetic mutations influencing other proteins such as alpha-globin complicating the clinical picture.

Specifications

Form

Liquid

General info

Function

Involved in oxygen transport from the lung to the various peripheral tissues.. LVV-hemorphin-7 potentiates the activity of bradykinin, causing a decrease in blood pressure.. Spinorphin. Functions as an endogenous inhibitor of enkephalin-degrading enzymes such as DPP3, and as a selective antagonist of the P2RX3 receptor which is involved in pain signaling, these properties implicate it as a regulator of pain and inflammation.

Sequence similarities

Belongs to the globin family.

Post-translational modifications

Glucose reacts non-enzymatically with the N-terminus of the beta chain to form a stable ketoamine linkage. This takes place slowly and continuously throughout the 120-day life span of the red blood cell. The rate of glycation is increased in patients with diabetes mellitus.. S-nitrosylated; a nitric oxide group is first bound to Fe(2+) and then transferred to Cys-94 to allow capture of O(2).. Acetylated on Lys-60, Lys-83 and Lys-145 upon aspirin exposure.

Product protocols

Target data

Involved in oxygen transport from the lung to the various peripheral tissues.. LVV-hemorphin-7 potentiates the activity of bradykinin, causing a decrease in blood pressure.. Spinorphin. Functions as an endogenous inhibitor of enkephalin-degrading enzymes such as DPP3, and as a selective antagonist of the P2RX3 receptor which is involved in pain signaling, these properties implicate it as a regulator of pain and inflammation.
See full target information HBB

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com