JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB95347

Recombinant Human Hemoglobin subunit zeta protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Hemoglobin subunit zeta protein (His tag C-Terminus) is a Human Full Length protein, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

HBZ2, HBZ, Hemoglobin subunit zeta, HBAZ, Hemoglobin zeta chain, Zeta-globin

3 Images
Western blot - Recombinant Human Hemoglobin subunit zeta protein (His tag C-Terminus) (AB95347)
  • WB

Lab

Western blot - Recombinant Human Hemoglobin subunit zeta protein (His tag C-Terminus) (AB95347)

**Blocking/Dilution buffer : ** 5% NFDM/TBST.

All lanes:

Western blot - Anti-Hemoglobin subunit beta antibody [EPR20614] (<a href='/en-us/products/primary-antibodies/hemoglobin-subunit-beta-antibody-epr20614-ab214049'>ab214049</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) (<a href='/en-us/products/proteins-peptides/recombinant-human-hemoglobin-subunit-alpha-protein-denatured-ab131697'>ab131697</a>) at 0.01 µg

Lane 2:

His-tagged human Hemoglobin subunit beta/ba1 (aa3-147) recombinant protein at 0.01 µg

Lane 3:

His-tagged human Hemoglobin subunit delta (aa3-147) recombinant protein at 0.01 µg

Lane 4:

His-tagged human Hemoglobin subunit epsilon (aa3-147) recombinant protein at 0.01 µg

Lane 5:

His-tagged human Hemoglobin subunit Gamma-2 (aa2-147) recombinant protein at 0.01 µg

Lane 6:

His-tagged human Hemoglobin subunit Gamma-1 (aa2-147) recombinant protein at 0.01 µg

Lane 7:

Western blot - Recombinant Human Hemoglobin subunit zeta protein (His tag C-Terminus) (ab95347) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 16 kDa

Observed band size: 15 kDa

true

Exposure time: 3s

Western blot - Recombinant Human Hemoglobin subunit zeta protein (His tag C-Terminus) (AB95347)
  • WB

Supplier Data

Western blot - Recombinant Human Hemoglobin subunit zeta protein (His tag C-Terminus) (AB95347)

Blocking/Dilutiing buffer and concentration : 5% NFDM/TBST Exposure time : 100 seconds

All lanes:

Western blot - Anti-Hemoglobin subunit beta + Hemoglobin subunit delta antibody [EPR8322(B)] (<a href='/en-us/products/primary-antibodies/hemoglobin-subunit-beta-hemoglobin-subunit-delta-antibody-epr8322b-ab131225'>ab131225</a>) at 1/200 dilution

Lane 1:

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) (<a href='/en-us/products/proteins-peptides/recombinant-human-hemoglobin-subunit-alpha-protein-denatured-ab131697'>ab131697</a>) at 0.1 µg

Lane 2:

His-tagged human Hemoglobin subunit beta/ba1 (aa 3-147) recombinant protein at 0.1 µg

Lane 3:

His-tagged human Hemoglobin subunit delta (aa 3-147) recombinant protein at 0.1 µg

Lane 4:

His-tagged full length human Hemoglobin subunit delta recombinant protein at 0.1 µg

Lane 5:

His-tagged human Hemoglobin subunit epsilon (aa 3-147) recombinant protein at 0.1 µg

Lane 6:

His-tagged human Hemoglobin subunit gamma-2 (aa 2-147) recombinant protein at 0.1 µg

Lane 7:

His-tagged human Hemoglobin subunit gamma-1 (aa 2-147) recombinant protein at 0.1 µg

Lane 8:

Western blot - Recombinant Human Hemoglobin subunit zeta protein (His tag C-Terminus) (ab95347) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

false

SDS-PAGE - Recombinant Human Hemoglobin subunit zeta protein (AB95347)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Hemoglobin subunit zeta protein (AB95347)

15% SDS-PAGE analysis of 3μg ab95347.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P02008

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYRLEHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P02008","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Hemoglobin subunit zeta also known as HBZ or ζ-globin is a protein subunit of hemoglobin present predominantly during early embryonic stages. It is a part of the alpha-globin gene cluster located on chromosome 16. This protein typically measures approximately 16 kDa in molecular weight. Expression of the zeta subunit is mostly confined to embryonic tissues including the yolk sac and early erythroid cells. Throughout development the presence of HBZ is significantly reduced as other globin genes take precedence for fetal and adult hemoglobin production.
Biological function summary

Hemoglobin subunit zeta plays a role in the formation of embryonic hemoglobin specifically the ζ2ε2 or Gower-1 hemoglobin complex. This complex facilitates the transfer of oxygen from the mother to the developing embryo. The zeta subunit interacts with other globin genes to form early hemoglobin types critical for oxygen transport at this stage. It enables the initial establishment of a functional circulatory system during early development.

Pathways

The Hemoglobin subunit zeta engages in the oxygen transport pathway important to the early stages of embryogenesis. As part of this pathway it directly interacts with epsilon-globin to form the embryonic Gower-1 hemoglobin. This pathway operates in parallel with but distinctly from the fetal hemoglobin pathway involving alpha and gamma globins. These interactions illustrate the complex switch and regulation of globin gene expression that occurs as development progresses.

Hemoglobin subunit zeta has associations with hemoglobinopathies such as alpha-thalassemia. Mutations or deletions in the alpha-globin gene cluster can impact HBZ production contributing to anemia and related disorders. Additionally its dysregulation can be a marker for developmental delays in hematopoiesis. Interactions with the alpha-globin proteins highlight the clinical relevance of studying HBZ mutations and their impacts on blood disorders.

Specifications

Form

Liquid

Additional notes

ab95347 is purified using conventional chromatography techniques.

General info

Function

The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.

Sequence similarities

Belongs to the globin family.

Product protocols

Target data

The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.
See full target information HBZ

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com