JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114285

Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (GST tag N-Terminus) is a Human Fragment protein, in the 25 to 134 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Basement membrane-specific heparan sulfate proteoglycan core protein, HSPG, Perlecan, PLC, HSPG2

1 Images
SDS-PAGE - Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (GST tag N-Terminus) (AB114285)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (GST tag N-Terminus) (AB114285)

12.5% SDS-PAGE showing ab114285 at approximately 37.73kDa stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

P98160

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein).</p>" } } }

Product details

Protein concentration is above or equal to 0.05 μg/μL.

This product was previously labelled as Heparan Sulfate Proteoglycan 2.

Sequence info

[{"sequence":"GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSV","proteinLength":"Fragment","predictedMolecularWeight":"37.84 kDa","actualMolecularWeight":null,"aminoAcidEnd":134,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P98160","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Heparan Sulfate Proteoglycan 2 also known as Perlecan is a large multidomain proteoglycan with a mass of over 500 kDa. It contains heparan sulfate chains that contribute to its role in the extracellular matrix. Perlecan is expressed in various tissues including cartilage basement membranes and vascular tissues. It interacts with other matrix proteins providing structural integrity and influencing cell behavior.
Biological function summary

Perlecan plays a critical role in cell adhesion proliferation and growth factor signaling. It is an important component of basement membranes and forms a structural complex with other matrix proteins. Its interaction with heparan sulfate chains enables binding with various ligands such as growth factors and cytokines optimizing their availability and functionality at the cell surface. This interaction is essential in tissue maintenance and repair processes.

Pathways

Perlecan participates in the regulation of the Wnt and Hedgehog signaling pathways. These pathways influence key developmental processes and dictate cellular differentiation and migration. Perlecan and its heparan sulfate chains modulate protein interactions within these pathways notably affecting proteins such as Dsh and Ctnnb1 which are essential in signal transduction.

Perlecan involvement has been linked with tumorigenesis and cardiovascular diseases. Aberrations in its structure or expression can alter cellular microenvironments impacting key processes like angiogenesis and metastasis. Furthermore its interaction with growth factors can facilitate the progression of diseases like cancer highlighting its connection with proteins such as VEGF and TGF-beta which play major roles in disease modulation.

Specifications

Form

Liquid

Additional notes

Glutathione Sepharose 4 Fast Flow

General info

Function

Integral component of basement membranes. Component of the glomerular basement membrane (GBM), responsible for the fixed negative electrostatic membrane charge, and which provides a barrier which is both size- and charge-selective. It serves as an attachment substrate for cells. Plays essential roles in vascularization. Critical for normal heart development and for regulating the vascular response to injury. Also required for avascular cartilage development (PubMed : 12435733, PubMed : 15591058, PubMed : 19789387). In muscle, it is essential for localizing acetylcholinesterase (AChE) at the neuromuscular junctions (NMJ), most probably acting as an adapter that links the acetylcholinesterase collagenic tail peptide (COLQ) to alpha-dystroglycan, and is therefore involved in the down-regulation of colinergic synaptic transmission (By similarity).. Endorepellin. Anti-angiogenic and anti-tumor peptide that inhibits endothelial cell migration, collagen-induced endothelial tube morphogenesis and blood vessel growth in the chorioallantoic membrane. Blocks endothelial cell adhesion to fibronectin and type I collagen. Anti-tumor agent in neovascularization. Interaction with its ligand, integrin alpha2/beta1, is required for the anti-angiogenic properties. Evokes a reduction in phosphorylation of receptor tyrosine kinases via alpha2/beta1 integrin-mediated activation of the tyrosine phosphatase, PTPN6.. LG3 peptide. Has anti-angiogenic properties that require binding of calcium ions for full activity.

Post-translational modifications

Proteolytic processing produces the C-terminal angiogenic peptide, endorepellin. This peptide can be further processed to produce the LG3 peptide.. O-glycosylated with core 1 or possibly core 8 glycans. Contains three heparan sulfate chains. Also contains chondroitin sulfate.

Product protocols

Target data

Integral component of basement membranes. Component of the glomerular basement membrane (GBM), responsible for the fixed negative electrostatic membrane charge, and which provides a barrier which is both size- and charge-selective. It serves as an attachment substrate for cells. Plays essential roles in vascularization. Critical for normal heart development and for regulating the vascular response to injury. Also required for avascular cartilage development (PubMed : 12435733, PubMed : 15591058, PubMed : 19789387). In muscle, it is essential for localizing acetylcholinesterase (AChE) at the neuromuscular junctions (NMJ), most probably acting as an adapter that links the acetylcholinesterase collagenic tail peptide (COLQ) to alpha-dystroglycan, and is therefore involved in the down-regulation of colinergic synaptic transmission (By similarity).. Endorepellin. Anti-angiogenic and anti-tumor peptide that inhibits endothelial cell migration, collagen-induced endothelial tube morphogenesis and blood vessel growth in the chorioallantoic membrane. Blocks endothelial cell adhesion to fibronectin and type I collagen. Anti-tumor agent in neovascularization. Interaction with its ligand, integrin alpha2/beta1, is required for the anti-angiogenic properties. Evokes a reduction in phosphorylation of receptor tyrosine kinases via alpha2/beta1 integrin-mediated activation of the tyrosine phosphatase, PTPN6.. LG3 peptide. Has anti-angiogenic properties that require binding of calcium ions for full activity.
See full target information Basement membrane-specific heparan sulfate proteoglycan core protein

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com