JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB132374

Recombinant Human Hepcidin protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Hepcidin protein (GST tag N-Terminus) is a Human Full Length protein, in the 25 to 84 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

HEPC, LEAP1, UNQ487/PRO1003, HAMP, Hepcidin, Liver-expressed antimicrobial peptide 1, Putative liver tumor regressor, LEAP-1, PLTR

1 Images
SDS-PAGE - Recombinant Human Hepcidin protein (GST tag N-Terminus) (AB132374)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Hepcidin protein (GST tag N-Terminus) (AB132374)

12.5% SDS-PAGE analysis of ab132374 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

P81172

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT","proteinLength":"Full Length","predictedMolecularWeight":"32.34 kDa","actualMolecularWeight":null,"aminoAcidEnd":84,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P81172","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Hepcidin also known as Liver-Expressed Antimicrobial Peptide (LEAP) or HEPC is an important regulator of iron homeostasis functioning as a hormone. It consists of a small peptide typically around 25 amino acids in length with a molecular mass of approximately 2.8 kDa. Hepcidin is produced predominantly in the liver and is secreted into the bloodstream where it directly binds to the iron export protein ferroportin. This binding induces ferroportin's internalization and degradation effectively restricting iron release into the circulation and controlling systemic iron levels.
Biological function summary

This hormone plays a critical role in maintaining iron balance within the body by regulating both the absorption of dietary iron in the intestine and the release of stored iron from macrophages and hepatocytes. Hepcidin operates independently and is not part of any larger complex. Its levels fluctuate in response to various stimuli including iron levels inflammation and erythropoietic demand impacting iron transport and storage.

Pathways

Hepcidin is integral to the iron metabolism pathway. It interacts intricately with proteins such as transferrin and ferritin which are involved in iron transport and storage. Hepcidin's function is modulated by the BMP/SMAD signaling pathway as well where its expression is promoted by these signaling proteins. This regulation ensures that iron levels are properly maintained for critical processes such as hemoglobin synthesis and cellular respiration.

Hepcidin is connected to conditions such as anemia of chronic disease and hereditary hemochromatosis. In anemia of chronic disease increased hepcidin levels lead to iron sequestration and restricted availability which contributes to the anemic state. In hereditary hemochromatosis mutations can result in decreased hepcidin activity causing excessive iron accumulation in the body. Through these mechanisms hepcidin's interactions with proteins such as ferroportin and transferrin receptor 2 influence the development and progression of these iron-related disorders.

Specifications

Form

Liquid

General info

Function

Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin/SLC40A1, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma (PubMed : 22682227, PubMed : 29237594, PubMed : 32814342). Controls the major flows of iron into plasma : absorption of dietary iron in the intestine, recycling of iron by macrophages, which phagocytose old erythrocytes and other cells, and mobilization of stored iron from hepatocytes (PubMed : 22306005).. Has strong antimicrobial activity against E.coli ML35P N.cinerea and weaker against S.epidermidis, S.aureus and group b streptococcus bacteria. Active against the fungus C.albicans. No activity against P.aeruginosa (PubMed : 11034317, PubMed : 11113131).

Sequence similarities

Belongs to the hepcidin family.

Product protocols

Target data

Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin/SLC40A1, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma (PubMed : 22682227, PubMed : 29237594, PubMed : 32814342). Controls the major flows of iron into plasma : absorption of dietary iron in the intestine, recycling of iron by macrophages, which phagocytose old erythrocytes and other cells, and mobilization of stored iron from hepatocytes (PubMed : 22306005).. Has strong antimicrobial activity against E.coli ML35P N.cinerea and weaker against S.epidermidis, S.aureus and group b streptococcus bacteria. Active against the fungus C.albicans. No activity against P.aeruginosa (PubMed : 11034317, PubMed : 11113131).
See full target information HAMP

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com