JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB180352

Recombinant Human HERC5 protein - BSA and Azide free (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human HERC5 protein - BSA and Azide free (His tag N-Terminus) is a Human Fragment protein, in the 681 to 1024 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

CEB1, CEBP1, HERC5, E3 ISG15--protein ligase HERC5, Cyclin-E-binding protein 1, HECT domain and RCC1-like domain-containing protein 5

1 Images
SDS-PAGE - Recombinant Human HERC5 protein - BSA and Azide free (His tag N-Terminus) (AB180352)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human HERC5 protein - BSA and Azide free (His tag N-Terminus) (AB180352)

15% SDS-PAGE analysis of ab180352 (3 μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9UII4

Animal free

No

Carrier free

Yes

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Protein previously labeled as HECT E3 ubiquitin ligase.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSFDLTVRRNHLIEDVLNQLSQFENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFAEMIQPEYGMFMYPEGASCMWFPVKPKFEKKRYFFFGVLCGLSLFNCNVANLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQTLLDDEGDNFEEVFYIHFNVHWDRNDTNLIPNGSSITVNQTNKRDYVSKYINYIFNDSVKAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG","proteinLength":"Fragment","predictedMolecularWeight":"43 kDa","actualMolecularWeight":null,"aminoAcidEnd":1024,"aminoAcidStart":681,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UII4","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The HERC5 protein also known as HECT and RLD domain containing E3 ubiquitin protein ligase 5 functions mechanically as an E3 ubiquitin ligase involved in the post-translational modification process called ISGylation. It facilitates the attachment of ubiquitin-like protein ISG15 to target proteins. HERC5 has a molecular mass of approximately 112 kDa. Expression of HERC5 is mainly in human cells especially in high quantities in the spleen lung and kidney. The expression is often elevated by type I interferons indicating a role in immune response.
Biological function summary

The HERC5 protein contributes to innate immune response by modifying proteins involved in antiviral defense. It adds ISG15 to newly synthesized proteins marking them for rapid degradation or altering their activities. HERC5 operates as a solitary protein rather than forming part of a larger complex. Through its ISGylation activity HERC5 plays a significant role in enhancing the antiviral state of cells inhibiting viral replication and modulating cellular processes during stress responses.

Pathways

HERC5 actively integrates into the antiviral defense mechanism and ubiquitin-proteasome pathway. It associates with pathways related to protein modification and immune signaling significantly affecting how cells respond to viral infections. Proteins like ISG15 and ubiquitin-conjugating enzymes interact with HERC5 in these pathways highlighting its importance in maintaining cellular homeostasis and protecting against pathogens.

The HERC5 protein shows connections with viral infections and certain inflammatory conditions. Its heightened activity associates with viral diseases like influenza and hepatitis where enhanced ISGylation occurs as a defensive strategy against viral proliferation. Misregulation of ISGylation through HERC5 also relates to neuroinflammatory disorders suggesting that targeting this pathway may offer therapeutic potential. Researchers continue exploring the interaction of HERC5 with proteins linked to these conditions to better understand its impact on disease progression and potential interventions.

Specifications

Form

Liquid

General info

Function

Major E3 ligase for ISG15 conjugation (PubMed : 26355087, PubMed : 27534820, PubMed : 27564865, PubMed : 34572049, PubMed : 37279284). Acts as a positive regulator of innate antiviral response in cells induced by interferon. Functions as part of the ISGylation machinery that recognizes target proteins in a broad and relatively non-specific manner. Catalyzes ISGylation of IRF3 which results in sustained activation, it attenuates IRF3-PIN1 interaction, which antagonizes IRF3 ubiquitination and degradation, and boosts the antiviral response. Mediates ISGylation of the phosphatase PTEN leading to its degradation, thus alleviating its suppression of the PI3K-AKT signaling pathway and promoting the production of cytokines that facilitate bacterial clearance (PubMed : 37279284). Interferes with the function of key viral structural proteins such as ebolavirus structural protein VP40 or HIV-1 protein GAG (PubMed : 22093708, PubMed : 34572049). Catalyzes ISGylation of influenza A viral NS1 which attenuates virulence; ISGylated NS1 fails to form homodimers and thus to interact with its RNA targets. Catalyzes ISGylation of papillomavirus type 16 L1 protein which results in dominant-negative effect on virus infectivity. Physically associated with polyribosomes, broadly modifies newly synthesized proteins in a cotranslational manner. In an interferon-stimulated cell, newly translated viral proteins are primary targets of ISG15. Promotes parkin/PRKN ubiquitin E3 ligase activity by suppressing the intramolecular interaction that maintains its autoinhibited conformation (PubMed : 27534820).. (Microbial infection) Functions as an E3 ligase for ISGylation of hepatitis B virus protein X leading to enhanced viral replication due to increased interferon resistance.

Post-translational modifications

ISGylated.

Product protocols

Target data

Major E3 ligase for ISG15 conjugation (PubMed : 26355087, PubMed : 27534820, PubMed : 27564865, PubMed : 34572049, PubMed : 37279284). Acts as a positive regulator of innate antiviral response in cells induced by interferon. Functions as part of the ISGylation machinery that recognizes target proteins in a broad and relatively non-specific manner. Catalyzes ISGylation of IRF3 which results in sustained activation, it attenuates IRF3-PIN1 interaction, which antagonizes IRF3 ubiquitination and degradation, and boosts the antiviral response. Mediates ISGylation of the phosphatase PTEN leading to its degradation, thus alleviating its suppression of the PI3K-AKT signaling pathway and promoting the production of cytokines that facilitate bacterial clearance (PubMed : 37279284). Interferes with the function of key viral structural proteins such as ebolavirus structural protein VP40 or HIV-1 protein GAG (PubMed : 22093708, PubMed : 34572049). Catalyzes ISGylation of influenza A viral NS1 which attenuates virulence; ISGylated NS1 fails to form homodimers and thus to interact with its RNA targets. Catalyzes ISGylation of papillomavirus type 16 L1 protein which results in dominant-negative effect on virus infectivity. Physically associated with polyribosomes, broadly modifies newly synthesized proteins in a cotranslational manner. In an interferon-stimulated cell, newly translated viral proteins are primary targets of ISG15. Promotes parkin/PRKN ubiquitin E3 ligase activity by suppressing the intramolecular interaction that maintains its autoinhibited conformation (PubMed : 27534820).. (Microbial infection) Functions as an E3 ligase for ISGylation of hepatitis B virus protein X leading to enhanced viral replication due to increased interferon resistance.
See full target information HERC5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com