JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB87362

Recombinant Human HINT1 protein (Tag Free)

4

(1 Review)

|

(1 Publication)

Recombinant Human HINT1 protein (Tag Free) is a Human Full Length protein, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

HINT, PKCI1, PRKCNH1, HINT1, Adenosine 5'-monophosphoramidase HINT1, Desumoylating isopeptidase HINT1, Histidine triad nucleotide-binding protein 1, Protein kinase C inhibitor 1, Protein kinase C-interacting protein 1, PKCI-1

2 Images
Western blot - Recombinant Human HINT1 protein (Tag Free) (AB87362)
  • WB

Lab

Western blot - Recombinant Human HINT1 protein (Tag Free) (AB87362)

Western blot : Anti-SERPINB1/PI2 antibody [EPR13299] - Membrane Vesicle Marker ab190357 staining at 1/5000 dilution, shown in green; Mouse anti alpha Tubulin (ab7291) loading control staining at 1/20,000 dilution, shown in magenta. A band was observed at 40 kDa in Wild-type A549 cell lysates with no signal observed at this size in SERPINB1 knockout A549 cell line. To generate this image, samples were run on an SDS-PAGE gel then transferred onto a nitrocellulose membrane. Membranes were blocked in 3pc Milk in TBS-0.1 % Tween® 20 (TBS-T) before incubation with primary antibodies overnight at 4 °C. Blots were washed four times in TBS-T, incubated with secondary antibodies for 1 h at room temperature, washed again four times then imaged. Secondary antibodies used were Goat anti-Rabbit 800CW & Goat anti-Mouse 680RD at 1/20,000 dilution.

All lanes:

Western blot - Anti-HINT1 antibody [EPR5108] (<a href='/en-us/products/primary-antibodies/hint1-antibody-epr5108-ab124912'>ab124912</a>) at 1/500 dilution

Lane 1:

Wild-type HeLa at 20 µg

Lane 2:

Western blot - Human HINT1 knockout HeLa cell line (<a href='/en-us/products/cell-lines/human-hint1-knockout-hela-cell-line-ab265776'>ab265776</a>) at 20 µg

Lane 3:

Jurkat at 20 µg

Lane 4:

HeLa Membrane at 20 µg

Lane 5:

EMPTY

Lane 6:

Western blot - Recombinant Human HINT1 protein (Tag Free) (ab87362) at 0.1 µg

Secondary

Lanes 1 - 6:

Goat anti-Rabbit 800CW at 1/20000 dilution

Lanes 1 - 6:

Goat anti-Mouse 680RD at 1/20000 dilution

Predicted band size: 14 kDa

Observed band size: 14 kDa,37 kDa

false

SDS-PAGE - Recombinant Human HINT1 protein (Tag Free) (AB87362)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human HINT1 protein (Tag Free) (AB87362)

ab87362 on 15% SDS-PAGE (3μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P49773

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P49773","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C|-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

HINT1 also known as Histidine Triad Nucleotide-Binding Protein 1 is a hydrolyzing enzyme with a monomeric mass of approximately 14 kDa. It functions mechanically by catalyzing the phosphoramidate bond in nucleotides which releases free phosphates. HINT1 is part of the family of histidine triad proteins and is expressed broadly across various tissues including the brain heart and testis indicating its potential importance in those areas.
Biological function summary

Within cellular processes HINT1 plays a role as a transcriptional regulator especially influencing the p53 pathway and those involved in stress responses. It forms part of a complex with other proteins guiding cellular responses to DNA damage. This activity strongly suggests HINT1's role in maintaining genomic stability and influencing cell cycle checkpoints.

Pathways

Several important signaling cascades involve HINT1 such as p53 and MAPK pathways. In the context of the p53 pathway HINT1 enhances tumor suppression activities by regulating transcription and apoptosis processes. Through the MAPK pathway it influences cell proliferation and apoptosis. Other proteins like p53 itself and c-Myc closely interact with HINT1 within these signaling pathways coordinating responses to cellular stress and growth signals.

There is a strong association between HINT1 and cancer as well as neuropathic disorders. Its role in tumor suppression suggests that dysfunction or altered expression may contribute to cancer progression particularly cancers related to the lung and colon. Moreover studies indicate a link between HINT1 and schizophrenia where alterations in protein expression can affect neural signaling. Proteins such as p53 and NMDAR which are altered in these disorders connect to HINT1 further displaying its significance in the development and progression of these diseases.

Specifications

Form

Liquid

Additional notes

Purified by using conventional chromatography.

General info

Function

Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2 (PubMed : 15703176, PubMed : 16835243, PubMed : 17217311, PubMed : 17337452, PubMed : 22329685, PubMed : 23614568, PubMed : 28691797, PubMed : 29787766, PubMed : 31990367). Hydrolyzes adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate) (PubMed : 15703176, PubMed : 16835243). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, as well as Met-AMP, His-AMP and Asp-AMP, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester (PubMed : 15703176, PubMed : 17337452, PubMed : 22329685). Hydrolyzes 3-indolepropionic acyl-adenylate, tryptamine adenosine phosphoramidate monoester and other fluorogenic purine nucleoside tryptamine phosphoramidates in vitro (PubMed : 17217311, PubMed : 17337452, PubMed : 23614568, PubMed : 28691797, PubMed : 29787766, PubMed : 31990367). Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide (PubMed : 30772266). In addition, functions as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1 (PubMed : 16014379, PubMed : 22647378). Modulates p53/TP53 levels and p53/TP53-mediated apoptosis (PubMed : 16835243). Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (PubMed : 19112177). Also exhibits SUMO-specific isopeptidase activity, deconjugating SUMO1 from RGS17 (PubMed : 31088288). Deconjugates SUMO1 from RANGAP1 (By similarity).

Sequence similarities

Belongs to the HINT family.

Subcellular localisation

Nucleus

Product protocols

Target data

Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2 (PubMed : 15703176, PubMed : 16835243, PubMed : 17217311, PubMed : 17337452, PubMed : 22329685, PubMed : 23614568, PubMed : 28691797, PubMed : 29787766, PubMed : 31990367). Hydrolyzes adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate) (PubMed : 15703176, PubMed : 16835243). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, as well as Met-AMP, His-AMP and Asp-AMP, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester (PubMed : 15703176, PubMed : 17337452, PubMed : 22329685). Hydrolyzes 3-indolepropionic acyl-adenylate, tryptamine adenosine phosphoramidate monoester and other fluorogenic purine nucleoside tryptamine phosphoramidates in vitro (PubMed : 17217311, PubMed : 17337452, PubMed : 23614568, PubMed : 28691797, PubMed : 29787766, PubMed : 31990367). Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide (PubMed : 30772266). In addition, functions as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1 (PubMed : 16014379, PubMed : 22647378). Modulates p53/TP53 levels and p53/TP53-mediated apoptosis (PubMed : 16835243). Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (PubMed : 19112177). Also exhibits SUMO-specific isopeptidase activity, deconjugating SUMO1 from RGS17 (PubMed : 31088288). Deconjugates SUMO1 from RANGAP1 (By similarity).
See full target information HINT1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Antioxidants & redox signaling 31:503-520 PubMed31088288

2019

The Axonal Motor Neuropathy-Related HINT1 Protein Is a Zinc- and Calmodulin-Regulated Cysteine SUMO Protease.

Applications

Unspecified application

Species

Unspecified reactive species

Elsa Cortés-Montero,María Rodríguez-Muñoz,Pilar Sánchez-Blázquez,Javier Garzón
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com