JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159993

Recombinant Human HIST1H2AK protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human HIST1H2AK protein is a Human Fragment protein, in the 25 to 96 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

H2AFP, HIST1H2AG, H2AC13, H2AFC, HIST1H2AI, H2AC15, H2AFD, HIST1H2AK, H2AC16, H2AFI, HIST1H2AL, H2AC17, H2AFN, HIST1H2AM, H2AC11, Histone H2A type 1, H2A.1, Histone H2A/ptl

1 Images
SDS-PAGE - Recombinant Human HIST1H2AK protein (AB159993)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human HIST1H2AK protein (AB159993)

ab159993 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P0C0S8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":96,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P0C0S8","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

HIST1H2AK also known as histone H2A type 1 or H2A.1 forms part of the histone protein family. This protein is a smaller component of chromatin with a molecular mass around 14 kDa. HIST1H2AK displays expression throughout various tissues where it contributes to the structural unit of nucleosomes. It participates in organizing DNA into chromatin being integral to compacting DNA within the nucleus and thereby regulating DNA accessibility.
Biological function summary

Histone H2A type 1 plays an important role in DNA packaging and gene regulation. As part of the nucleosome it combines with other histone proteins to wrap DNA acting as the central unit of chromatin structure. It interacts with several nuclear proteins to modify chromatin’s biochemical state thereby affecting gene expression patterns. HIST1H2AK as a component of this histone complex participates in controlling genetic information critical for cellular function and response to environmental cues.

Pathways

This histone protein type is linked to pathways managing chromatin remodeling and DNA repair processes. Its presence in the nucleosome assembly pathway associates it with epigenetic regulation mechanisms notably impacting gene silencing and expression adjustments through histone modifications. Related proteins such as histone H4 and histone deacetylases (HDACs) work together in these pathways to induce changes in chromatin conformation important for regulating access to genetic material.

The role of HIST1H2AK in chromatin structure implicates it in cancer and neurodegenerative diseases. Alterations in HIST1H2AK expression or modification often correlate with tumor progression and metastasis highlighting its involvement in oncogenic pathways. In neurodegenerative disorders interactions with proteins like p53 and HDACs suggest connections between irregular chromatin states and neuronal cell death indicating a potential involvement in diseases like Alzheimer's.

Specifications

Form

Liquid

General info

Function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Sequence similarities

Belongs to the histone H2A family.

Post-translational modifications

Deiminated on Arg-4 in granulocytes upon calcium entry.. Monoubiquitination of Lys-120 (H2AK119Ub) by RING1, TRIM37 and RNF2/RING2 complex gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. It is involved in the initiation of both imprinted and random X inactivation. Ubiquitinated H2A is enriched in inactive X chromosome chromatin. Ubiquitination of H2A functions downstream of methylation of 'Lys-27' of histone H3 (H3K27me). H2AK119Ub by RNF2/RING2 can also be induced by ultraviolet and may be involved in DNA repair. Monoubiquitination of Lys-120 (H2AK119Ub) by TRIM37 may promote transformation of cells in a number of breast cancers (PubMed:25470042). Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties by the E2 ligase UBE2N and the E3 ligases RNF8 and RNF168, leading to the recruitment of repair proteins to sites of DNA damage. Ubiquitination at Lys-14 and Lys-16 (H2AK13Ub and H2AK15Ub, respectively) in response to DNA damage is initiated by RNF168 that mediates monoubiquitination at these 2 sites, and 'Lys-63'-linked ubiquitin are then conjugated to monoubiquitin; RNF8 is able to extend 'Lys-63'-linked ubiquitin chains in vitro. Deubiquitinated by USP51 at Lys-14 and Lys-16 (H2AK13Ub and H2AK15Ub, respectively) after damaged DNA is repaired (PubMed:27083998). H2AK119Ub and ionizing radiation-induced 'Lys-63'-linked ubiquitination (H2AK13Ub and H2AK15Ub) are distinct events.. Phosphorylation on Ser-2 (H2AS1ph) is enhanced during mitosis. Phosphorylation on Ser-2 by RPS6KA5/MSK1 directly represses transcription. Acetylation of H3 inhibits Ser-2 phosphorylation by RPS6KA5/MSK1. Phosphorylation at Thr-121 (H2AT120ph) by DCAF1 is present in the regulatory region of many tumor suppresor genes and down-regulates their transcription.. Symmetric dimethylation on Arg-4 by the PRDM1/PRMT5 complex may play a crucial role in the germ-cell lineage.. Glutamine methylation at Gln-105 (H2AQ104me) by FBL is specifically dedicated to polymerase I. It is present at 35S ribosomal DNA locus and impairs binding of the FACT complex (PubMed:24352239).. Crotonylation (Kcr) is specifically present in male germ cells and marks testis-specific genes in post-meiotic cells, including X-linked genes that escape sex chromosome inactivation in haploid cells. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. It is also associated with post-meiotically activated genes on autosomes.. Lactylated in macrophages by EP300/P300 by using lactoyl-CoA directly derived from endogenous or exogenous lactate, leading to stimulates gene transcription.

Subcellular localisation

Nucleus

Product protocols

Target data

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
See full target information H2AC11

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com