JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB134863

Recombinant Human Histone H2A.X protein

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Human Histone H2A.X protein is a Human Full Length protein, in the 1 to 143 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

H2AFX, H2AX, Histone H2AX, H2a/x, Histone H2A.X

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P16104

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: Glycerol (glycerin, glycerine), Potassium chloride, Sodium chloride, 3.4% DL-Arginine, 0.32% Tris HCl, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% EDTA

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY","proteinLength":"Full Length","predictedMolecularWeight":"15 kDa","actualMolecularWeight":null,"aminoAcidEnd":143,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P16104","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

Additional notes

ab134863 was constructed and expressed in E. coli, refolded using “temperature shift inclusion body refolding” technology, purified chromatographically and sterile filtered.

General info

Function

The protein expressed by the H2AX gene is a variant histone H2A that replaces conventional H2A in certain nucleosomes, which are responsible for wrapping and compacting DNA into chromatin. This compaction limits DNA accessibility to cellular machineries that require DNA as a template, placing histones at the center of transcription regulation, DNA repair, DNA replication, and chromosomal stability. DNA accessibility is controlled through a complex array of post-translational histone modifications, known as the histone code, and nucleosome remodeling. The H2AX protein is essential for the checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for the efficient repair of DNA double strand breaks (DSBs), particularly when it undergoes C-terminal phosphorylation. This supplementary information is collated from multiple sources and compiled automatically.

Sequence similarities

Belongs to the histone H2A family.

Post-translational modifications

Phosphorylated by VRK1 (PubMed:31527692). Phosphorylated on Ser-140 (to form gamma-H2AX or H2AX139ph) in response to DNA double strand breaks (DSBs) generated by exogenous genotoxic agents and by stalled replication forks, and may also occur during meiotic recombination events and immunoglobulin class switching in lymphocytes. Phosphorylation can extend up to several thousand nucleosomes from the actual site of the DSB and may mark the surrounding chromatin for recruitment of proteins required for DNA damage signaling and repair. Widespread phosphorylation may also serve to amplify the damage signal or aid repair of persistent lesions. Phosphorylation of Ser-140 (H2AX139ph) in response to ionizing radiation is mediated by both ATM and PRKDC while defects in DNA replication induce Ser-140 phosphorylation (H2AX139ph) subsequent to activation of ATR and PRKDC. Dephosphorylation of Ser-140 by PP2A is required for DNA DSB repair. In meiosis, Ser-140 phosphorylation (H2AX139ph) may occur at synaptonemal complexes during leptotene as an ATM-dependent response to the formation of programmed DSBs by SPO11. Ser-140 phosphorylation (H2AX139ph) may subsequently occurs at unsynapsed regions of both autosomes and the XY bivalent during zygotene, downstream of ATR and BRCA1 activation. Ser-140 phosphorylation (H2AX139ph) may also be required for transcriptional repression of unsynapsed chromatin and meiotic sex chromosome inactivation (MSCI), whereby the X and Y chromosomes condense in pachytene to form the heterochromatic XY-body. During immunoglobulin class switch recombination in lymphocytes, Ser-140 phosphorylation (H2AX139ph) may occur at sites of DNA-recombination subsequent to activation of the activation-induced cytidine deaminase AICDA. Phosphorylation at Tyr-143 (H2AXY142ph) by BAZ1B/WSTF determines the relative recruitment of either DNA repair or pro-apoptotic factors. Phosphorylation at Tyr-143 (H2AXY142ph) favors the recruitment of APBB1/FE65 and pro-apoptosis factors such as MAPK8/JNK1, triggering apoptosis. In contrast, dephosphorylation of Tyr-143 by EYA proteins (EYA1, EYA2, EYA3 or EYA4) favors the recruitment of MDC1-containing DNA repair complexes to the tail of phosphorylated Ser-140 (H2AX139ph).. Monoubiquitination of Lys-120 (H2AXK119ub) by RING1 and RNF2/RING2 complex gives a specific tag for epigenetic transcriptional repression (By similarity). Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties by the E2 ligase UBE2N and the E3 ligases RNF8 and RNF168, leading to the recruitment of repair proteins to sites of DNA damage. Ubiquitination at Lys-14 and Lys-16 (H2AK13Ub and H2AK15Ub, respectively) in response to DNA damage is initiated by RNF168 that mediates monoubiquitination at these 2 sites, and 'Lys-63'-linked ubiquitin are then conjugated to monoubiquitin; RNF8 is able to extend 'Lys-63'-linked ubiquitin chains in vitro. H2AK119Ub and ionizing radiation-induced 'Lys-63'-linked ubiquitination (H2AK13Ub and H2AK15Ub) are distinct events.. Acetylation at Lys-6 (H2AXK5ac) by KAT5 component of the NuA4 histone acetyltransferase complex promotes NBN/NBS1 assembly at the sites of DNA damage (PubMed:17709392, PubMed:26438602). Acetylation at Lys-37 increases in S and G2 phases. This modification has been proposed to play a role in DNA double-strand break repair (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

The protein expressed by the H2AX gene is a variant histone H2A that replaces conventional H2A in certain nucleosomes, which are responsible for wrapping and compacting DNA into chromatin. This compaction limits DNA accessibility to cellular machineries that require DNA as a template, placing histones at the center of transcription regulation, DNA repair, DNA replication, and chromosomal stability. DNA accessibility is controlled through a complex array of post-translational histone modifications, known as the histone code, and nucleosome remodeling. The H2AX protein is essential for the checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for the efficient repair of DNA double strand breaks (DSBs), particularly when it undergoes C-terminal phosphorylation. This supplementary information is collated from multiple sources and compiled automatically.
See full target information H2AX

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Arteriosclerosis, thrombosis, and vascular biology 40:783-801 PubMed31969012

2020

PIM1 (Moloney Murine Leukemia Provirus Integration Site) Inhibition Decreases the Nonhomologous End-Joining DNA Damage Repair Signaling Pathway in Pulmonary Hypertension.

Applications

Unspecified application

Species

Unspecified reactive species

Marie-Claude Lampron,Géraldine Vitry,Valérie Nadeau,Yann Grobs,Renée Paradis,Nolwenn Samson,Ève Tremblay,Olivier Boucherat,Jolyane Meloche,Sébastien Bonnet,Steeve Provencher,François Potus,Roxane Paulin

Frontiers in oncology 9:1233 PubMed31799193

2019

Livin Regulates H2A.X Phosphorylation and Promotes Autophagy in Colon Cancer Cells via a Novel Kinase Activity.

Applications

Unspecified application

Species

Unspecified reactive species

Yang Ge,Bao-Lin Liu,Jun-Peng Cui,Shu-Qiang Li
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com