JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198757

Recombinant human Histone H3 protein (Active)

Be the first to review this product! Submit a review

|

(11 Publications)

Recombinant human Histone H3 protein (Active) is a Human Full Length protein in the 2 to 136 aa range,with >=90% purity and suitable for SDS-PAGE and Functional studies. The predicted molecular weight of ab198757 protein is 15.4 kDa.

- Save time and ensure accurate results - use our human Histone H3 protein as a control
- Optimal protein bioactivity and stability

View Alternative Names

H3FA, HIST1H3A, H3C2, H3FL, HIST1H3B, H3C3, H3FC HIST1H3C, H3C4, H3FB, HIST1H3D, H3C6, H3FD, HIST1H3E, H3C7, H3FI, HIST1H3F, H3C8, H3FH, HIST1H3G, H3C10, H3FK, HIST1H3H, H3C11, H3FF, HIST1H3I, H3C12, H3FJ, HIST1H3J, HIST1H3C, H3FC, H3C1, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l

2 Images
Functional Studies - Recombinant human Histone H3 protein (Active) (AB198757)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Histone H3 protein (Active) (AB198757)

Methylation of ab198757 by G9a.

SDS-PAGE - Recombinant human Histone H3 protein (Active) (AB198757)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Histone H3 protein (Active) (AB198757)

2μg ab198757 on 4-20% SDS-PAGE, stained with Coomassie.

MW=16.4 kDa due to glycosalation.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Assay Conditions: ab198757 was coated onto a 96-well plate, and methylation by G9a was carried out at room temperature for 60 min. Methylated ab198757 was detected using a Chemiluminescence assay.

Accession

P68431

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.0462% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.0165% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MMHHHHHHARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA","proteinLength":"Full Length","predictedMolecularWeight":"15.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":136,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P68431","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

The protein expressed by gene H3C1 is a core component of the nucleosome, which is essential for wrapping and compacting DNA into chromatin. This process restricts DNA accessibility to cellular machineries that use DNA as a template. Consequently, histones are central to transcription regulation, DNA repair, DNA replication, and chromosomal stability. DNA accessibility is regulated through a complex set of post-translational modifications of histones, known as the histone code, and through nucleosome remodeling. This supplementary information is collated from multiple sources and compiled automatically.

Sequence similarities

Belongs to the histone H3 family.

Post-translational modifications

Acetylation is generally linked to gene activation. Acetylation on Lys-10 (H3K9ac) impairs methylation at Arg-9 (H3R8me2s). Acetylation on Lys-19 (H3K18ac) and Lys-24 (H3K24ac) favors methylation at Arg-18 (H3R17me). Acetylation at Lys-123 (H3K122ac) by EP300/p300 plays a central role in chromatin structure: localizes at the surface of the histone octamer and stimulates transcription, possibly by promoting nucleosome instability.. Citrullination at Arg-9 (H3R8ci) and/or Arg-18 (H3R17ci) by PADI4 impairs methylation and represses transcription.. Asymmetric dimethylation at Arg-18 (H3R17me2a) by CARM1 is linked to gene activation. Symmetric dimethylation at Arg-9 (H3R8me2s) by PRMT5 is linked to gene repression. Asymmetric dimethylation at Arg-3 (H3R2me2a) by PRMT6 is linked to gene repression and is mutually exclusive with H3 Lys-5 methylation (H3K4me2 and H3K4me3). H3R2me2a is present at the 3' of genes regardless of their transcription state and is enriched on inactive promoters, while it is absent on active promoters.. Methylation at Lys-5 (H3K4me), Lys-37 (H3K36me) and Lys-80 (H3K79me) are linked to gene activation. Methylation at Lys-5 (H3K4me) facilitates subsequent acetylation of H3 and H4. Methylation at Lys-80 (H3K79me) is associated with DNA double-strand break (DSB) responses and is a specific target for TP53BP1. Methylation at Lys-10 (H3K9me) and Lys-28 (H3K27me) are linked to gene repression. Methylation at Lys-10 (H3K9me) is a specific target for HP1 proteins (CBX1, CBX3 and CBX5) and prevents subsequent phosphorylation at Ser-11 (H3S10ph) and acetylation of H3 and H4. Methylation at Lys-5 (H3K4me) and Lys-80 (H3K79me) require preliminary monoubiquitination of H2B at 'Lys-120'. Methylation at Lys-10 (H3K9me) and Lys-28 (H3K27me) are enriched in inactive X chromosome chromatin. Monomethylation at Lys-57 (H3K56me1) by EHMT2/G9A in G1 phase promotes interaction with PCNA and is required for DNA replication.. Phosphorylated at Thr-4 (H3T3ph) by VRK1 (PubMed:31527692). Phosphorylated at Thr-4 (H3T3ph) by HASPIN during prophase and dephosphorylated during anaphase (PubMed:15681610, PubMed:16185088). Phosphorylation at Ser-11 (H3S10ph) by AURKB is crucial for chromosome condensation and cell-cycle progression during mitosis and meiosis. In addition phosphorylation at Ser-11 (H3S10ph) by RPS6KA4 and RPS6KA5 is important during interphase because it enables the transcription of genes following external stimulation, like mitogens, stress, growth factors or UV irradiation and result in the activation of genes, such as c-fos and c-jun. Phosphorylation at Ser-11 (H3S10ph), which is linked to gene activation, prevents methylation at Lys-10 (H3K9me) but facilitates acetylation of H3 and H4. Phosphorylation at Ser-11 (H3S10ph) by AURKB mediates the dissociation of HP1 proteins (CBX1, CBX3 and CBX5) from heterochromatin. Phosphorylation at Ser-11 (H3S10ph) is also an essential regulatory mechanism for neoplastic cell transformation. Phosphorylated at Ser-29 (H3S28ph) by MAP3K20 isoform 1, RPS6KA5 or AURKB during mitosis or upon ultraviolet B irradiation. Phosphorylation at Thr-7 (H3T6ph) by PRKCB is a specific tag for epigenetic transcriptional activation that prevents demethylation of Lys-5 (H3K4me) by LSD1/KDM1A. At centromeres, specifically phosphorylated at Thr-12 (H3T11ph) from prophase to early anaphase, by DAPK3 and PKN1. Phosphorylation at Thr-12 (H3T11ph) by PKN1 or isoform M2 of PKM (PKM2) is a specific tag for epigenetic transcriptional activation that promotes demethylation of Lys-10 (H3K9me) by KDM4C/JMJD2C. Phosphorylation at Thr-12 (H3T11ph) by chromatin-associated CHEK1 regulates the transcription of cell cycle regulatory genes by modulating acetylation of Lys-10 (H3K9ac). Phosphorylation at Tyr-42 (H3Y41ph) by JAK2 promotes exclusion of CBX5 (HP1 alpha) from chromatin.. Monoubiquitinated by RAG1 in lymphoid cells, monoubiquitination is required for V(D)J recombination (By similarity). Ubiquitinated by the CUL4-DDB-RBX1 complex in response to ultraviolet irradiation. This may weaken the interaction between histones and DNA and facilitate DNA accessibility to repair proteins.. Lysine deamination at Lys-5 (H3K4all) to form allysine is mediated by LOXL2. Allysine formation by LOXL2 only takes place on H3K4me3 and results in gene repression.. Crotonylation (Kcr) is specifically present in male germ cells and marks testis-specific genes in post-meiotic cells, including X-linked genes that escape sex chromosome inactivation in haploid cells. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. It is also associated with post-meiotically activated genes on autosomes.. Butyrylation of histones marks active promoters and competes with histone acetylation. It is present during late spermatogenesis.. Succinylation at Lys-80 (H3K79succ) by KAT2A takes place with a maximum frequency around the transcription start sites of genes (PubMed:29211711). It gives a specific tag for epigenetic transcription activation (PubMed:29211711). Desuccinylation at Lys-123 (H3K122succ) by SIRT7 in response to DNA damage promotes chromatin condensation and double-strand breaks (DSBs) repair (PubMed:27436229).. Serine ADP-ribosylation by PARP1 or PARP2 constitutes the primary form of ADP-ribosylation of proteins in response to DNA damage (PubMed:30257210, PubMed:34874266). Serine ADP-ribosylation at Ser-11 (H3S10ADPr) promotes recruitment of CHD1L (PubMed:34874266). H3S10ADPr is mutually exclusive with phosphorylation at Ser-11 (H3S10ph) and impairs acetylation at Lys-10 (H3K9ac) (PubMed:30257210).. Serotonylated by TGM2 at Gln-6 (H3Q5ser) during serotonergic neuron differentiation (PubMed:30867594). H3Q5ser is associated with trimethylation of Lys-5 (H3K4me3) and enhances general transcription factor IID (TFIID) complex-binding to H3K4me3, thereby facilitating transcription (PubMed:30867594).. Dopaminylated by TGM2 at Gln-6 (H3Q5dop) in ventral tegmental area (VTA) neurons (PubMed:32273471). H3Q5dop mediates neurotransmission-independent role of nuclear dopamine by regulating relapse-related transcriptional plasticity in the reward system (By similarity).. Lactylated in macrophages by EP300/P300 by using lactoyl-CoA directly derived from endogenous or exogenous lactate, leading to stimulates gene transcription.

Subcellular localisation

Nucleus

Product protocols

Target data

The protein expressed by gene H3C1 is a core component of the nucleosome, which is essential for wrapping and compacting DNA into chromatin. This process restricts DNA accessibility to cellular machineries that use DNA as a template. Consequently, histones are central to transcription regulation, DNA repair, DNA replication, and chromosomal stability. DNA accessibility is regulated through a complex set of post-translational modifications of histones, known as the histone code, and through nucleosome remodeling. This supplementary information is collated from multiple sources and compiled automatically.
See full target information H3C1

Publications (11)

Recent publications for all applications. Explore the full list and refine your search

Frontiers in immunology 16:1540908 PubMed40421030

2025

Identification of a multiple DAMP scavenger mimicking the DAMP-binding site of TLR4 to ameliorate lethal sepsis.

Applications

Unspecified application

Species

Unspecified reactive species

Takuya Murao,Gaifeng Ma,Atsushi Murao,Alok Jha,Jingsong Li,Yongchan Lee,Mian Zhou,Ping Wang,Monowar Aziz

Nature communications 16:3174 PubMed40180916

2025

A noncanonical role of SAT1 enables anchorage independence and peritoneal metastasis in ovarian cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Cuimiao Zheng,Gang Niu,Hao Tan,Xi Huang,Jingyi Lu,Qiuwen Mai,Tiantian Yu,Chunyu Zhang,Siqi Chen,Mengxun Wei,Wenfeng Pan,Yu Guo,Jing Wang,Manman Xu,Shuzhong Yao,Junxiu Liu,Jie Li,Chaoyun Pan

Frontiers in pharmacology 14:1271435 PubMed38026973

2023

Cathepsin V regulates cell cycle progression and histone stability in the nucleus of breast cancer cells.

Applications

Unspecified application

Species

Unspecified reactive species

Naphannop Sereesongsaeng,James F Burrows,Christopher J Scott,Klaudia Brix,Roberta E Burden

The Journal of general physiology 155: PubMed37199689

2023

Extracellular histone proteins activate P2XR7 channel current.

Applications

Unspecified application

Species

Unspecified reactive species

Rua'a Al-Aqtash,Maxwell S Ross,Daniel M Collier

iScience 26:106372 PubMed37013187

2023

Histone H3 phospho-regulation by KimH3 in both interphase and mitosis.

Applications

Unspecified application

Species

Unspecified reactive species

Junjun Wang,Xiaofei Tian,Chuanlin Feng,Chao Song,Biao Yu,Ying Wang,Xinmiao Ji,Xin Zhang

EMBO reports 23:e54265 PubMed35766227

2022

Reduced symmetric dimethylation stabilizes vimentin and promotes metastasis in MTAP-deficient lung cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Wen-Hsin Chang,Yi-Ju Chen,Yi-Jing Hsiao,Ching-Cheng Chiang,Chia-Yu Wang,Ya-Ling Chang,Qi-Sheng Hong,Chien-Yu Lin,Shr-Uen Lin,Gee-Chen Chang,Hsuan-Yu Chen,Yu-Ju Chen,Ching-Hsien Chen,Pan-Chyr Yang,Sung-Liang Yu

Frontiers in oncology 11:664403 PubMed34055630

2021

Carnosol Is a Novel Inhibitor of p300 Acetyltransferase in Breast Cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Halima Alsamri,Hussain El Hasasna,Bincy Baby,Aysha Alneyadi,Yusra Al Dhaheri,Mohammed Akli Ayoub,Ali H Eid,Ranjit Vijayan,Rabah Iratni

Molecular oncology 14:1268-1281 PubMed32306542

2020

DAPK3 participates in the mRNA processing of immediate early genes in chronic lymphocytic leukaemia.

Applications

Unspecified application

Species

Unspecified reactive species

Fraser Thomas,Katie B Holmes,Sarah Kreuz,Peter Hillmen,Pascal F Lefevre

Cancer discovery 10:980-997 PubMed32269030

2020

Gain-of-Function Genetic Alterations of G9a Drive Oncogenesis.

Applications

Unspecified application

Species

Unspecified reactive species

Shinichiro Kato,Qing Yu Weng,Megan L Insco,Kevin Y Chen,Sathya Muralidhar,Joanna Pozniak,Joey Mark S Diaz,Yotam Drier,Nhu Nguyen,Jennifer A Lo,Ellen van Rooijen,Lajos V Kemeny,Yao Zhan,Yang Feng,Whitney Silkworth,C Thomas Powell,Brian B Liau,Yan Xiong,Jian Jin,Julia Newton-Bishop,Leonard I Zon,Bradley E Bernstein,David E Fisher

International journal of molecular sciences 20: PubMed31574902

2019

Tyr198 is the Essential Autophosphorylation Site for STK16 Localization and Kinase Activity.

Applications

Unspecified application

Species

Unspecified reactive species

Junjun Wang,Juanjuan Liu,Xinmiao Ji,Xin Zhang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com