JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198115

Recombinant Human Histone H4 protein

Be the first to review this product! Submit a review

|

(3 Publications)

Recombinant Human Histone H4 protein is a Human Full Length protein, in the 2 to 103 aa range, expressed in Escherichia coli, with >75%, suitable for SDS-PAGE.

View Alternative Names

H4/A, H4FA, HIST1H4A, H4C2, H4/I, H4FI, HIST1H4B, H4C3, H4/G, H4FG, HIST1H4C, H4C4, H4/B, H4FB, HIST1H4D, H4C5, H4/J, H4FJ, HIST1H4E, H4C6, H4/C, H4FC, HIST1H4F, H4C8, H4/H, H4FH, HIST1H4H, H4C9, H4/M, H4FM, HIST1H4I, H4C11, H4/E, H4FE, HIST1H4J, H4C12, H4/D, H4FD, HIST1H4K, H4C13, H4/K, H4FK, HIST1H4L, H4C14, H4/N, H4F2, H4FN, HIST2H4, HIST2H4A, H4C15, H4/O, H4FO, HIST2H4B, H4C16, H4-16, HIST4H4, H4C1, Histone H4, H4K8cr

1 Images
SDS-PAGE - Recombinant Human Histone H4 protein (AB198115)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Histone H4 protein (AB198115)

4-20% SDS-PAGE analysis of ab198115.

Lane 1 : 2 μg ab198115
Lane 2 : Protein marker

Stained with Coomassie Blue

Key facts

Purity

>75% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P62805

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

ab198115 is useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.

Sequence info

[{"sequence":"SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG","proteinLength":"Full Length","predictedMolecularWeight":"12.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":103,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P62805","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Sequence similarities

Belongs to the histone H4 family.

Post-translational modifications

Acetylation at Lys-6 (H4K5ac), Lys-9 (H4K8ac), Lys-13 (H4K12ac) and Lys-17 (H4K16ac) occurs in coding regions of the genome but not in heterochromatin.. Citrullination at Arg-4 (H4R3ci) by PADI4 impairs methylation.. Monomethylation and asymmetric dimethylation at Arg-4 (H4R3me1 and H4R3me2a, respectively) by PRMT1 favors acetylation at Lys-9 (H4K8ac) and Lys-13 (H4K12ac). Demethylation is performed by JMJD6. Symmetric dimethylation on Arg-4 (H4R3me2s) by the PRDM1/PRMT5 complex may play a crucial role in the germ-cell lineage.. Monomethylated, dimethylated or trimethylated at Lys-21 (H4K20me1, H4K20me2, H4K20me3) (PubMed:12086618, PubMed:15964846, PubMed:17967882). Monomethylation is performed by KMT5A/SET8 (PubMed:15964846). Dimethylation and trimethylation is performed by KMT5B and KMT5C and induces gene silencing (By similarity). Monomethylated at Lys-13 (H4K12me1) by N6AMT1; H4K12me1 modification is present at the promoters of numerous genes encoding cell cycle regulators (PubMed:31061526).. Acetyl-methylated at Lys-6 and Lys-13 (H4K5acme and H4K12acme, respectively), acetyl-methylation is an epigenetic mark of active chromatin associated with increased transcriptional initiation (PubMed:37731000). Acetyl-methylation is formed by acetylation by EP300/p300 of lysine residues that are already monomethylated on the same side chain (PubMed:37731000). H4K5acme and H4K12acme marks specifically bind BRD2 (PubMed:37731000).. Phosphorylated by PAK2 at Ser-48 (H4S47ph). This phosphorylation increases the association of H3.3-H4 with the histone chaperone HIRA, thus promoting nucleosome assembly of H3.3-H4 and inhibiting nucleosome assembly of H3.1-H4.. Ubiquitinated by the CUL4-DDB-RBX1 complex in response to ultraviolet irradiation. This may weaken the interaction between histones and DNA and facilitate DNA accessibility to repair proteins. Monoubiquitinated at Lys-92 of histone H4 (H4K91ub1) in response to DNA damage. The exact role of H4K91ub1 in DNA damage response is still unclear but it may function as a licensing signal for additional histone H4 post-translational modifications such as H4 Lys-21 methylation (H4K20me).. Ufmylated; monofmylated by UFL1 at Lys-32 (H4K31Ufm1) in response to DNA damage.. Sumoylated, which is associated with transcriptional repression.. Crotonylation (Kcr) is specifically present in male germ cells and marks testis-specific genes in post-meiotic cells, including X-linked genes that escape sex chromosome inactivation in haploid cells. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. It is also associated with post-meiotically activated genes on autosomes.. Butyrylation of histones marks active promoters and competes with histone acetylation.. Glutarylation at Lys-92 (H4K91glu) destabilizes nucleosomes by promoting dissociation of the H2A-H2B dimers from nucleosomes.. Lactylated in macrophages by EP300/P300 by using lactoyl-CoA directly derived from endogenous or exogenous lactate, leading to stimulates gene transcription (PubMed:31645732). Delactylated by SIRT3 at Lys-17 (H4K16la) (PubMed:37720100).

Subcellular localisation

Nucleus

Product protocols

Target data

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
See full target information H4C1 crotonyl K8

Publications (3)

Recent publications for all applications. Explore the full list and refine your search

The Journal of general physiology 155: PubMed37199689

2023

Extracellular histone proteins activate P2XR7 channel current.

Applications

Unspecified application

Species

Unspecified reactive species

Rua'a Al-Aqtash,Maxwell S Ross,Daniel M Collier

EMBO reports 23:e54265 PubMed35766227

2022

Reduced symmetric dimethylation stabilizes vimentin and promotes metastasis in MTAP-deficient lung cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Wen-Hsin Chang,Yi-Ju Chen,Yi-Jing Hsiao,Ching-Cheng Chiang,Chia-Yu Wang,Ya-Ling Chang,Qi-Sheng Hong,Chien-Yu Lin,Shr-Uen Lin,Gee-Chen Chang,Hsuan-Yu Chen,Yu-Ju Chen,Ching-Hsien Chen,Pan-Chyr Yang,Sung-Liang Yu

Clinical epigenetics 12:126 PubMed32819448

2020

Circulating histone signature of human lean metabolic-associated fatty liver disease (MAFLD).

Applications

Unspecified application

Species

Unspecified reactive species

Diana Buzova,Andrea Maugeri,Antonio Liguori,Cecilia Napodano,Oriana Lo Re,Jude Oben,Anna Alisi,Antonio Gasbarrini,Antonio Grieco,Jan Cerveny,Luca Miele,Manlio Vinciguerra
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com