JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB216178

Recombinant Human Histones protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Histones protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 130 aa range, expressed in Escherichia coli, suitable for SDS-PAGE.

View Alternative Names

H2BFQ, HIST2H2BE, H2BC21, Histone H2B type 2-E, H2B-clustered histone 21, Histone H2B-GL105, Histone H2B.q, H2B/q, H2AW, HIST3H2A, H2AC25, Histone H2A type 3, H2A-clustered histone 25

1 Images
Functional Studies - Recombinant Human Histones protein (His tag N-Terminus) (AB216178)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human Histones protein (His tag N-Terminus) (AB216178)

ab216178 used as substrate for PARP1 enzyme activity.

Key facts

Purity

undefined SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q16778

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Optimized for use as a substrate for PARPs. Also useful as a substrate for histone acetyltransferases or methyltransferases. This is a 5x mixture of human Histones H2A and H2B.

Sequence info

[{"sequence":"MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK","proteinLength":"Full Length","predictedMolecularWeight":"14.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":130,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q7L7L0","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK","proteinLength":"Full Length","predictedMolecularWeight":"14.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":126,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q16778","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Histones sometimes known as histone proteins are key structural proteins in chromatin found in the nucleus of eukaryotic cells. Each histone protein has an approximate mass range of 11 to 21 kDa depending on the specific type—H1 H2A H2B H3 or H4—that makes up the core histones. These core histones form octamers around which DNA winds to create nucleosomes. Histones are ubiquitously expressed across eukaryotic organisms highlighting their fundamental role in packaging and maintaining the integrity of genetic material.
Biological function summary

These proteins play an essential role in gene regulation. As part of a complex with DNA histones are involved in chromatin remodeling making them integral to controlling the accessibility of DNA for transcription and replication. Histone modifications such as acetylation and methylation serve as signals for the recruitment of protein complexes that modulate chromatin structure influencing gene expression patterns. These modifications on histone proteins are dynamic and reversible providing a flexible mechanism for regulating cellular functions in response to environmental cues.

Pathways

Histone modifications are critical to several cellular processes. These include the regulation of the cell cycle and the DNA damage repair pathway. In the cell cycle histone proteins undergo specific changes that influence chromatin structure facilitating progression through different phases. In the DNA repair process histone modifications help to signal and recruit repair proteins to sites of damage ensuring genomic stability. Interactions with proteins like DNA methyltransferases and acetyltransferases position histones as central players in these pathways linking chromatin dynamics to important cellular functions.

Histone modifications have connections with cancer and neurodegenerative diseases. In cancer aberrant histone modifications lead to misexpression of oncogenes or tumor suppressor genes fundamentally contributing to tumorigenesis. Mutations in histone-related genes have been identified in various cancers highlighting the role of histone proteins in the pathology of this disorder. In neurodegenerative diseases altered histone acetylation patterns can affect gene expression profiles impacting neuronal function and survival. Histones therefore link to broader networks of proteins such as the polycomb group proteins in cancer pathways underlining their relevance to disease mechanisms.

Specifications

Form

Liquid

General info

Function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.

Sequence similarities

Belongs to the histone H2B family.

Post-translational modifications

Monoubiquitination at Lys-35 (H2BK34Ub) by the MSL1/MSL2 dimer is required for histone H3 'Lys-4' (H3K4me) and 'Lys-79' (H3K79me) methylation and transcription activation at specific gene loci, such as HOXA9 and MEIS1 loci. Similarly, monoubiquitination at Lys-121 (H2BK120Ub) by the RNF20/40 complex gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation. It also functions cooperatively with the FACT dimer to stimulate elongation by RNA polymerase II. H2BK120Ub also acts as a regulator of mRNA splicing: deubiquitination by USP49 is required for efficient cotranscriptional splicing of a large set of exons.. Phosphorylation at Ser-37 (H2BS36ph) by AMPK in response to stress promotes transcription (By similarity). Phosphorylated on Ser-15 (H2BS14ph) by STK4/MST1 during apoptosis; which facilitates apoptotic chromatin condensation (PubMed:12757711). Also phosphorylated on Ser-15 in response to DNA double strand breaks (DSBs), and in correlation with somatic hypermutation and immunoglobulin class-switch recombination.. GlcNAcylation at Ser-113 promotes monoubiquitination of Lys-121. It fluctuates in response to extracellular glucose, and associates with transcribed genes (By similarity).. ADP-ribosylated by PARP1 or PARP2 on Ser-7 (H2BS6ADPr) in response to DNA damage (PubMed:34874266). H2BS6ADPr promotes recruitment of CHD1L (PubMed:34874266). Mono-ADP-ribosylated on Glu-3 (H2BE2ADPr) by PARP3 in response to single-strand breaks (PubMed:27530147). Poly ADP-ribosylation on Glu-36 (H2BE35ADPr) by PARP1 regulates adipogenesis: it inhibits phosphorylation at Ser-37 (H2BS36ph), thereby blocking expression of pro-adipogenetic genes (By similarity).. Crotonylation (Kcr) is specifically present in male germ cells and marks testis-specific genes in post-meiotic cells, including X-linked genes that escape sex chromosome inactivation in haploid cells. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. It is also associated with post-meiotically activated genes on autosomes.. Lactylated in macrophages by EP300/P300 by using lactoyl-CoA directly derived from endogenous or exogenous lactate, leading to stimulates gene transcription.

Subcellular localisation

Nucleus

Product protocols

Target data

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.
See full target information H2BC21

Additional targets

H2AC25

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com