JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB104668

Recombinant Human hnRNP C1/C2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human hnRNP C1/C2 protein is a Human Full Length protein, in the 1 to 293 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

HNRPC, HNRNPC, Heterogeneous nuclear ribonucleoproteins C1/C2, hnRNP C1/C2

1 Images
SDS-PAGE - Recombinant Human hnRNP C1/C2 protein (AB104668)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human hnRNP C1/C2 protein (AB104668)

15% SDS-PAGE showing ab104668 at approximately 34.5kDa (3μg).
Note : Real molecular weight on SDS-PAGE is shifted up compared to predicted molecular weight.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P07910

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as hnRNP C1 + C2

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS","proteinLength":"Full Length","predictedMolecularWeight":"34.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":293,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P07910","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

HnRNP C1/C2 also known as heterogeneous nuclear ribonucleoprotein C comprises two alternatively spliced proteins C1 protein and C2 protein which have molecular weights of approximately 39 kDa and 41 kDa respectively. These proteins function mainly in the nucleus and are expressed ubiquitously in various tissues. They play a fundamental role in mRNA processing including pre-mRNA splicing polyadenylation and stabilization. As components of the hnRNP complex they bind to nascent RNA transcripts to regulate their maturation and transport.
Biological function summary

HnRNP C1/C2 participates in the assembly of large ribonucleoprotein complexes that are essential for mRNA metabolism. It acts as a core component of the spliceosome machinery where it influences the alternative splicing of pre-mRNA. Apart from its structural role hnRNP C1/C2 may contribute to the proper assembly and functioning of splicing factors and other proteins such as 4f4 within the nucleus suggesting its important role in gene expression regulation.

Pathways

HnRNP C1/C2 is involved in the RNA processing pathway directly impacting mRNA export and stability. By interacting with other proteins such as serine/arginine-rich splicing factors it modulates the splicing accuracy and efficiency of various transcripts. This participation in the spliceosome pathway emphasizes its importance in ensuring efficient gene expression and processing. hnRNP C1/C2 might also interact with various transcription machinery components linking RNA processing to transcriptional regulation.

HnRNP C1/C2 links to neurological diseases and certain cancers. In neurological disorders misregulation of hnRNP C1/C2 can result in aberrant mRNA splicing which may contribute to the pathogenesis of diseases like spinal muscular atrophy. Its involvement in cancer is related to its ability to modulate gene expression and cellular proliferation often observed in tumors with disrupted mRNA processing pathways. HnRNP C1/C2 interactions with proteins such as the tumor suppressor p53 may influence cell cycle regulation and contribute to tumor progression.

Specifications

Form

Liquid

Additional notes

ab104668 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Binds pre-mRNA and nucleates the assembly of 40S hnRNP particles (PubMed : 8264621). Interacts with poly-U tracts in the 3'-UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules (PubMed : 12509468, PubMed : 16010978, PubMed : 7567451, PubMed : 8264621). Single HNRNPC tetramers bind 230-240 nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides (PubMed : 8264621). May play a role in the early steps of spliceosome assembly and pre-mRNA splicing. N6-methyladenosine (m6A) has been shown to alter the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm(6)A-switch', facilitating binding of HNRNPC, leading to regulation of mRNA splicing (PubMed : 25719671).

Sequence similarities

Belongs to the RRM HNRPC family. RALY subfamily.

Post-translational modifications

Phosphorylated on Ser-260 and Ser-299 in resting cells. Phosphorylated on Ser-253 and on 1 serine residue in the poly-Ser stretch at position 238 in response to hydrogen peroxide.. Sumoylated. Sumoylation reduces affinity for mRNA.. Ubiquitinated and degraded after nucleo-cytoplasmic transport by YWHAE.

Subcellular localisation

Nucleus

Product protocols

Target data

Binds pre-mRNA and nucleates the assembly of 40S hnRNP particles (PubMed : 8264621). Interacts with poly-U tracts in the 3'-UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules (PubMed : 12509468, PubMed : 16010978, PubMed : 7567451, PubMed : 8264621). Single HNRNPC tetramers bind 230-240 nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides (PubMed : 8264621). May play a role in the early steps of spliceosome assembly and pre-mRNA splicing. N6-methyladenosine (m6A) has been shown to alter the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm(6)A-switch', facilitating binding of HNRNPC, leading to regulation of mRNA splicing (PubMed : 25719671).
See full target information HNRNPC

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com