JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152450

Recombinant Human hnRNP D/AUF1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human hnRNP D/AUF1 protein is a Human Full Length protein, in the 1 to 355 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

AUF1, HNRPD, HNRNPD, Heterogeneous nuclear ribonucleoprotein D0, hnRNP D0, AU-rich element RNA-binding protein 1

1 Images
SDS-PAGE - Recombinant Human hnRNP D/AUF1 protein (AB152450)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human hnRNP D/AUF1 protein (AB152450)

12.5% SDS-PAGE gel analysis of ab152450 stained with Coomassie Blue

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

Q14103

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY","proteinLength":"Full Length","predictedMolecularWeight":"64.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":355,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q14103","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The hnRNP D/AUF1 protein also known as heterogeneous nuclear ribonucleoprotein D has a molecular mass of approximately 37-40 kDa. It plays a significant role in the cellular machinery by binding to RNA molecules mainly impacting mRNA stability and turnover. The protein is expressed ubiquitously in various tissues throughout the body indicating its importance in numerous cellular functions. It is one of the hnRNP family members involved in the post-transcriptional regulation of gene expression.
Biological function summary

HnRNP D/AUF1 regulates the degradation of mRNA by binding to AU-rich elements (AREs) found in the 3' untranslated region of many genes. It is an integral part of RNA-protein complexes that are important for controlling the half-life of mRNAs. Besides mRNA decay hnRNP D/AUF1 participates in other processes like mRNA splicing and transport. Its interactions within the ribonucleoprotein complexes highlight its versatile role in RNA metabolism.

Pathways

HnRNP D/AUF1 operates within important biological processes such as the mRNA decay pathway and the stress response pathway. It interacts closely with other proteins involved in mRNA decay such as tristetraprolin and members of the poly-A binding protein family. hnRNP D/AUF1 influences the decay rate of different transcripts contributing to cellular responses to environmental stimuli and maintaining homeostasis.

HnRNP D/AUF1 links to inflammatory conditions and some types of cancer. Altered expression levels of AUF1 have been associated with chronic inflammation where its role in mRNA stability impacts the expression of cytokines. In cancer dysregulation of AUF1 can lead to incorrect mRNA turnover of tumor suppressors or oncogenes linking it to proteins like p53 in the context of tumorigenesis. These associations make hnRNP D/AUF1 a potential target for therapeutic interventions in related diseases.

Specifications

Form

Liquid

General info

Function

Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Also binds to double- and single-stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single-stranded non-monotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats. Binding of RRM1 to DNA inhibits the formation of DNA quadruplex structure which may play a role in telomere elongation. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. May play a role in the regulation of the rhythmic expression of circadian clock core genes. Directly binds to the 3'UTR of CRY1 mRNA and induces CRY1 rhythmic translation. May also be involved in the regulation of PER2 translation.

Post-translational modifications

Arg-345 is dimethylated, probably to asymmetric dimethylarginine.. Methylated by PRMT1, in an insulin-dependent manner. The PRMT1-mediated methylation regulates tyrosine phosphorylation (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Also binds to double- and single-stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single-stranded non-monotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats. Binding of RRM1 to DNA inhibits the formation of DNA quadruplex structure which may play a role in telomere elongation. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. May play a role in the regulation of the rhythmic expression of circadian clock core genes. Directly binds to the 3'UTR of CRY1 mRNA and induces CRY1 rhythmic translation. May also be involved in the regulation of PER2 translation.
See full target information HNRNPD

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com