JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB124548

Recombinant Human HP1 gamma/CBX3 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human HP1 gamma/CBX3 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 183 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Chromobox protein homolog 3, HECH, Heterochromatin protein 1 homolog gamma, Modifier 2 protein, HP1 gamma, CBX3

1 Images
SDS-PAGE - Recombinant Human HP1 gamma/CBX3 protein (His tag N-Terminus) (AB124548)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human HP1 gamma/CBX3 protein (His tag N-Terminus) (AB124548)

15% SDS-PAGE (3 μg loaded)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q13185

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as HP1 gamma

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ","proteinLength":"Full Length","predictedMolecularWeight":"23.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":183,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13185","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The HP1 gamma protein also known as CBX3 is an essential component of the chromatin organization machinery. It has a molecular weight of approximately 22-25 kDa. HP1 gamma is expressed in a variety of tissues including brain liver and muscle indicating its broad functional involvement across different biological systems. It exhibits a high affinity for binding to histone H3 when it is methylated facilitating the formation of heterochromatin which is key to regulating gene expression and maintaining genome stability.
Biological function summary

HP1 gamma plays a significant role in gene silencing and chromatin structure maintenance. It forms part of a protein complex that includes chromatin remodeling enzymes and transcriptional repressors which help regulate access to genomic DNA. HP1 gamma's association with other chromatin-associated proteins helps modulate the transcriptional response to cellular stimuli ensuring appropriate gene expression patterns needed for normal cell function and development.

Pathways

HP1 gamma is involved in heterochromatin formation and maintenance pathways working alongside other proteins like SUV39H1 and HP1 alpha. Through these pathways HP1 gamma ensures the compact organization of repetitive DNA sequences and suppresses unnecessary transcription. It is also involved in the DNA damage response pathway playing a role in preserving genomic integrity by interacting with proteins such as BRCA1 and 53BP1 involved in DNA repair.

HP1 gamma's dysregulation has been associated with cancer and neurological disorders. Overexpression or mutations in this protein can lead to aberrant gene silencing contributing to oncogenesis where cancer-related genes become improperly regulated. Additionally alterations in HP1 gamma function are linked to neurodegenerative diseases potentially through its interaction with proteins like MECP2 whereby changes in the chromatin environment influence neuronal gene expression and function. Therefore understanding HP1 gamma's role provides insights into potential therapeutic targets for these conditions.

Specifications

Form

Liquid

Additional notes

Purified by using conventional chromatography.

General info

Function

Seems to be involved in transcriptional silencing in heterochromatin-like complexes. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. May contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR). Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins. Contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 'Lys-9' trimethylation, mediates the recruitment of the methyltransferases SUV39H1 and/or SUV39H2 by the PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1. Mediates the recruitment of NIPBL to sites of DNA damage at double-strand breaks (DSBs) (PubMed : 28167679).

Post-translational modifications

Phosphorylated by PIM1. Phosphorylated during interphase and possibly hyper-phosphorylated during mitosis.

Subcellular localisation

Nucleus

Product protocols

Target data

Seems to be involved in transcriptional silencing in heterochromatin-like complexes. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. May contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR). Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins. Contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 'Lys-9' trimethylation, mediates the recruitment of the methyltransferases SUV39H1 and/or SUV39H2 by the PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1. Mediates the recruitment of NIPBL to sites of DNA damage at double-strand breaks (DSBs) (PubMed : 28167679).
See full target information CBX3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com