JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB86922

Recombinant Human HRASLS3 protein (Tag Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human HRASLS3 protein (Tag Free) is a Human Fragment protein, in the 1 to 133 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

HRASLS3, HREV107, PLA2G16, PLAAT3, Phospholipase A and acyltransferase 3, Adipose-specific phospholipase A2, Group XVI phospholipase A1/A2, H-rev 107 protein homolog, HRAS-like suppressor 1, HRAS-like suppressor 3, HREV107-3, Renal carcinoma antigen NY-REN-65, AdPLA, H-REV107, HREV107-1, HRSL3

1 Images
SDS-PAGE - Recombinant Human HRASLS3 protein (Tag Free) (AB86922)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human HRASLS3 protein (Tag Free) (AB86922)

ab86922 on 15% SDS-PAGE (3μg)

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P53816

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.316% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDV","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":133,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P53816","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

Additional notes

purified by conventional chromatography techniques.

General info

Function

Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed : 19047760, PubMed : 19615464, PubMed : 22605381, PubMed : 22825852, PubMed : 26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids (PubMed : 19047760, PubMed : 19615464, PubMed : 22605381, PubMed : 22825852, PubMed : 22923616). For most substrates, PLA1 activity is much higher than PLA2 activity (PubMed : 19615464). Shows O-acyltransferase activity,catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid (PubMed : 19615464). Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs) (PubMed : 19047760, PubMed : 19615464, PubMed : 22605381, PubMed : 22825852). Exhibits high N-acyltransferase activity and low phospholipase A1/2 activity (PubMed : 22825852). Required for complete organelle rupture and degradation that occur during eye lens terminal differentiation, when fiber cells that compose the lens degrade all membrane-bound organelles in order to provide lens with transparency to allow the passage of light. Organelle membrane degradation is probably catalyzed by the phospholipase activity (By similarity).. (Microbial infection) Acts as a host factor for picornaviruses : required during early infection to promote viral genome release into the cytoplasm (PubMed : 28077878). May act as a cellular sensor of membrane damage at sites of virus entry, which relocalizes to sites of membrane rupture upon virus unfection (PubMed : 28077878). Facilitates safe passage of the RNA away from LGALS8, enabling viral genome translation by host ribosome (PubMed : 28077878). May also be involved in initiating pore formation, increasing pore size or in maintaining pores for genome delivery (PubMed : 28077878). The lipid-modifying enzyme activity is required for this process (PubMed : 28077878).

Sequence similarities

Belongs to the H-rev107 family.

Subcellular localisation

Peroxisome membrane

Product protocols

Target data

Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed : 19047760, PubMed : 19615464, PubMed : 22605381, PubMed : 22825852, PubMed : 26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids (PubMed : 19047760, PubMed : 19615464, PubMed : 22605381, PubMed : 22825852, PubMed : 22923616). For most substrates, PLA1 activity is much higher than PLA2 activity (PubMed : 19615464). Shows O-acyltransferase activity,catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid (PubMed : 19615464). Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs) (PubMed : 19047760, PubMed : 19615464, PubMed : 22605381, PubMed : 22825852). Exhibits high N-acyltransferase activity and low phospholipase A1/2 activity (PubMed : 22825852). Required for complete organelle rupture and degradation that occur during eye lens terminal differentiation, when fiber cells that compose the lens degrade all membrane-bound organelles in order to provide lens with transparency to allow the passage of light. Organelle membrane degradation is probably catalyzed by the phospholipase activity (By similarity).. (Microbial infection) Acts as a host factor for picornaviruses : required during early infection to promote viral genome release into the cytoplasm (PubMed : 28077878). May act as a cellular sensor of membrane damage at sites of virus entry, which relocalizes to sites of membrane rupture upon virus unfection (PubMed : 28077878). Facilitates safe passage of the RNA away from LGALS8, enabling viral genome translation by host ribosome (PubMed : 28077878). May also be involved in initiating pore formation, increasing pore size or in maintaining pores for genome delivery (PubMed : 28077878). The lipid-modifying enzyme activity is required for this process (PubMed : 28077878).
See full target information PLAAT3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com