JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB215028

Recombinant human ICOS protein (Fc Chimera Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human ICOS protein (Fc Chimera Active) is a Human Fragment protein, in the 21 to 139 aa range, expressed in CHO cells, with >98%, < 0.06 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

CD278, AILIM, ICOS, Inducible T-cell costimulator, Activation-inducible lymphocyte immunomediatory molecule

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 0.06 EU/µg

Expression system

CHO cells

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Measured by its ability to inhibit human T cell proliferation induced by human CD275:Fc in the presence of anti-CD3.

Accession

Q9Y6W8

Animal free

No

Carrier free

Yes

Species

Human

Reconstitution

Reconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.

Storage buffer

Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQL","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":139,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"CHO cells","accessionNumber":"Q9Y6W8","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Inducible T-cell costimulator (ICOS) also known as AILIM or CD278 is a member of the CD28 superfamily of proteins. ICOS is a surface receptor protein approximately 60 kDa in mass. This protein is expressed mainly on activated T cells. It does not appear on naive or resting T cells. ICOS plays an important mechanical role in the immune response as its engagement enhances the production of cytokines and supports cell-cell interactions through its binding to the ICOS ligand.
Biological function summary

ICOS plays a critical role in the regulation of immune responses. It acts as a costimulatory signal for T cells supporting their proliferation and differentiation. ICOS helps form part of a complex involving interactions with the ICOS ligand present on antigen-presenting cells. This interaction affects the function and fate of various T cell subsets including T follicular helper cells which are important for antibody production.

Pathways

ICOS is part of the immune signaling pathway. It associates closely with the CD28 signaling pathway enhancing T-cell activation and survival. ICOS interacts with proteins such as the ICOS ligand (ICOSL) on antigen-presenting cells which helps mediate its effects. These pathways are essential in immune system homeostasis and adaptive immune responses where dysfunction can lead to immune-related diseases.

ICOS has implications in conditions such as autoimmune diseases and cancer. Abnormal expression or function of ICOS relates to the development of autoimmune conditions like systemic lupus erythematosus (SLE) where the overactive immune response damages the body's tissues. Additionally ICOS might support tumor progression in certain types of cancers by promoting immune escape. It interacts with regulatory proteins like CTLA-4 and PD-1 in these diseases which are notably involved in immune checkpoint pathways.

Specifications

Form

Lyophilized

General info

Function

Stimulatory receptor expressed in activated or antigen-experienced T-cells that plays an important role in the immune response (PubMed : 9930702). Upon binding to its ligand ICOSL expressed on antigen presenting cells (APCs), delivers costimulatory signals that enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines including IL10, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells (PubMed : 33033255). Acts also as a costimulatory receptor critical for the differentiation of T follicular regulatory cells upon immune challenges such as viral infection (PubMed : 27135603). Mechanistically, potentiates TCR-induced calcium flux by augmenting PLCG1 activation and actin remodeling (By similarity). In addition, activates PI3K signaling pathways independently of calcium flux (PubMed : 30523347). Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes (By similarity).

Post-translational modifications

N-glycosylated.

Product protocols

Target data

Stimulatory receptor expressed in activated or antigen-experienced T-cells that plays an important role in the immune response (PubMed : 9930702). Upon binding to its ligand ICOSL expressed on antigen presenting cells (APCs), delivers costimulatory signals that enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines including IL10, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells (PubMed : 33033255). Acts also as a costimulatory receptor critical for the differentiation of T follicular regulatory cells upon immune challenges such as viral infection (PubMed : 27135603). Mechanistically, potentiates TCR-induced calcium flux by augmenting PLCG1 activation and actin remodeling (By similarity). In addition, activates PI3K signaling pathways independently of calcium flux (PubMed : 30523347). Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes (By similarity).
See full target information ICOS

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com