JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152882

Recombinant Human IFITM1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IFITM1 protein is a Human Full Length protein, in the 1 to 125 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

CD225, IFI17, IFITM1, Interferon-induced transmembrane protein 1, Dispanin subfamily A member 2a, Interferon-induced protein 17, Interferon-inducible protein 9-27, Leu-13 antigen, DSPA2a

1 Images
SDS-PAGE - Recombinant Human IFITM1 protein (AB152882)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human IFITM1 protein (AB152882)

12.5% SDS-PAGE analysis of ab152882 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

P13164

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY","proteinLength":"Full Length","predictedMolecularWeight":"39.49 kDa","actualMolecularWeight":null,"aminoAcidEnd":125,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P13164","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IFITM1 also known as Interferon-Induced Transmembrane Protein 1 has a molecular weight of approximately 14 kDa. It is a transmembrane protein that plays an important role in host defense mechanisms. IFITM1 is expressed in various tissues including the respiratory tract gastrointestinal tract and the immune system where it serves in defending against pathogenic infections. The protein is usually found on the cell membrane and becomes highly expressed in response to interferon signaling.
Biological function summary

This protein inhibits viral entry by restricting the fusion of viral membranes with host cell membranes. IFITM1 does not function alone; it is part of the IFITM family which includes IFITM2 and IFITM3 each contributing to antiviral defense. The protein is strategically positioned to prevent the spread of viruses by blocking them from entering new cells which is important for managing viral propagation.

Pathways

IFITM1 engages the innate immune response pathway responding to viral infections by acting as a barrier to viral entry. It works alongside related proteins such as IFITM2 and IFITM3 within this pathway. IFITM1 is also part of the interferon pathway where its expression is upregulated in response to interferon signals. This relationship highlights its role in the immune response acting as a frontline protector against the invasion of viruses like influenza and others.

IFITM1 has a significant role in the context of viral infections and certain cancers. It is linked to resistance to viral infections such as influenza showing its importance in antiviral defense. In cancer aberrant expression of IFITM1 is observed in various types including breast and colorectal cancers impacting tumor progression and metastasis. The relationship of IFITM1 with interferon signaling highlights potential therapeutic targets where modulating its activity could influence disease outcomes.

Specifications

Form

Liquid

General info

Function

IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and hepatitis C virus (HCV) (PubMed : 26354436, PubMed : 33270927). Can inhibit : influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV and SARS-CoV-2 S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration (PubMed : 33270927). Inhibits SARS-CoV-2 S protein-mediated syncytia formation (PubMed : 33051876). Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation (PubMed : 26354436). IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome (PubMed : 26354436).

Sequence similarities

Belongs to the CD225/Dispanin family.

Post-translational modifications

Palmitoylation on membrane-proximal cysteines controls clustering in membrane compartments and antiviral activity.

Subcellular localisation

Lysosome membrane

Product protocols

Target data

IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and hepatitis C virus (HCV) (PubMed : 26354436, PubMed : 33270927). Can inhibit : influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV and SARS-CoV-2 S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration (PubMed : 33270927). Inhibits SARS-CoV-2 S protein-mediated syncytia formation (PubMed : 33051876). Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation (PubMed : 26354436). IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome (PubMed : 26354436).
See full target information IFITM1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com