JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235874

Recombinant Human IFNGR1 protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human IFNGR1 protein (His tag C-Terminus) is a Human Fragment protein, in the 18 to 245 aa range, expressed in Baculovirus infected insect cells, with >90%, < 1 EU/µL endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD119, Interferon gamma receptor 1, IFN-gamma receptor 1, IFN-gamma-R1, CDw119, Interferon gamma receptor alpha-chain, IFN-gamma-R-alpha, IFNGR1

1 Images
SDS-PAGE - Recombinant Human IFNGR1 protein (His tag C-Terminus) (AB235874)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IFNGR1 protein (His tag C-Terminus) (AB235874)

15% SDS-PAGE analysis of 3 μg ab235874.

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µL

Expression system

Baculovirus infected insect cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P15260

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"26.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":245,"aminoAcidStart":18,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"P15260","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The IFNGR1 protein also known as Interferon Gamma Receptor 1 is an integral component of the cell surface receptor for interferon-gamma (IFN-γ). It possesses a mass of approximately 53 kDa. IFNGR1 is expressed in various cell types including immune cells such as T cells and macrophages and is also present in other cell lines like HEK 293. This receptor binds to its specific ligand IFN-γ initiating a series of intracellular events that are essential for immune response modulation.
Biological function summary

IFNGR1 functions as part of the interferon-gamma receptor complex working alongside the IFNGR2 subunit. This interaction with IFNGR2 is important for the receptor to properly transmit signals inside the cell. The binding of interferon-gamma to this receptor complex activates the JAK-STAT signaling pathway promoting the transcription of genes that enhance the antimicrobial activity of immune cells and regulate cellular immunity.

Pathways

The IFNGR1 protein plays an important role in the JAK-STAT signaling pathway which is critical for mediating responses to interferon-gamma. Upon activation by IFN-γ IFNGR1 recruits JAK kinases leading to the phosphorylation of STAT1 a significant transcription factor. STAT1 then dimerizes and translocates to the nucleus where it induces the expression of genes involved in immune defense and inflammation. This process is vital for the body's ability to handle infections and other immunological challenges.

IFNGR1 is associated with susceptibility to infections and certain immune-related disorders. Mutations or deficiencies in IFNGR1 can lead to Mendelian Susceptibility to Mycobacterial Disease (MSMD) where individuals show increased vulnerability to mycobacterial infections. Additionally improper signaling through IFNGR1 is linked to chronic granulomatous disease which can involve defective functioning of the NADPH oxidase complex. Understanding IFNGR1's function and interactions is important for exploring new therapeutic strategies for these disorders.

Specifications

Form

Liquid

Additional notes

ab235874 was expressed in insect cell and affinity purified.

General info

Function

Receptor subunit for interferon gamma/INFG that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (PubMed : 20015550). Associates with transmembrane accessory factor IFNGR2 to form a functional receptor (PubMed : 10986460, PubMed : 2971451, PubMed : 7615558, PubMed : 7617032, PubMed : 7673114). Upon ligand binding, the intracellular domain of IFNGR1 opens out to allow association of downstream signaling components JAK1 and JAK2. In turn, activated JAK1 phosphorylates IFNGR1 to form a docking site for STAT1. Subsequent phosphorylation of STAT1 leads to dimerization, translocation to the nucleus, and stimulation of target gene transcription (PubMed : 28883123). STAT3 can also be activated in a similar manner although activation seems weaker. IFNGR1 intracellular domain phosphorylation also provides a docking site for SOCS1 that regulates the JAK-STAT pathway by competing with STAT1 binding to IFNGR1 (By similarity).

Sequence similarities

Belongs to the type II cytokine receptor family.

Post-translational modifications

Phosphorylated at Ser/Thr residues. Phosphorylation of Tyr-457 is required for IFNG receptor signal transduction (PubMed:8156998). Influenza virus infection leads to phosphorylation in a CSNK1A1-dependent manner (PubMed:29343571).. Ubiquitinated after phosphorylation in a CSNK1A1-dependent manner, leading to the lysosome-dependent degradation (PubMed:29343571). Proteasomally degraded through 'Lys-48'-mediated ubiquitination (PubMed:28883123). Ubiquitination is necessary for efficient IFNGR1 signaling (PubMed:28883123).

Product protocols

Target data

Receptor subunit for interferon gamma/INFG that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (PubMed : 20015550). Associates with transmembrane accessory factor IFNGR2 to form a functional receptor (PubMed : 10986460, PubMed : 2971451, PubMed : 7615558, PubMed : 7617032, PubMed : 7673114). Upon ligand binding, the intracellular domain of IFNGR1 opens out to allow association of downstream signaling components JAK1 and JAK2. In turn, activated JAK1 phosphorylates IFNGR1 to form a docking site for STAT1. Subsequent phosphorylation of STAT1 leads to dimerization, translocation to the nucleus, and stimulation of target gene transcription (PubMed : 28883123). STAT3 can also be activated in a similar manner although activation seems weaker. IFNGR1 intracellular domain phosphorylation also provides a docking site for SOCS1 that regulates the JAK-STAT pathway by competing with STAT1 binding to IFNGR1 (By similarity).
See full target information IFNGR1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

The Journal of biological chemistry 300:107464 PubMed38879015

2024

Designing monomeric IFNγ: The significance of domain-swapped dimer structure in IFNγ immune responses.

Applications

Unspecified application

Species

Unspecified reactive species

Yota Goto,Takamitsu Miyafusa,Shinya Honda
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com