JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158743

Recombinant Human IgA2 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IgA2 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 477 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Immunoglobulin heavy constant alpha 2, Ig alpha-2 chain C region, Ig alpha-2 chain C region BUT, Ig alpha-2 chain C region LAN, IGHA2

1 Images
SDS-PAGE - Recombinant Human IgA2 protein (GST tag N-Terminus) (AB158743)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human IgA2 protein (GST tag N-Terminus) (AB158743)

ab158743 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

P01877

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQTAGKGLEWIGYISHSGSTTYNPSLKSRVTLSLDTSKNQFSLRLNSVTAADTAVYYCAHGSSWDFAFDYWGQGTLVTVSSASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":477,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P01877","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IgA2 also known as Immunoglobulin A2 is an antibody isotype mainly found in mucosal areas. It has a molecular mass of approximately 160 kDa. IgA2 is primarily expressed in the mucosal membranes lining the gut respiratory tract and urogenital tract playing an important role in the immune defense of these surfaces. It differs from IgA1 in the structure of the hinge region which is shorter and less likely to be cleaved by bacterial proteases providing enhanced protection at these sites.
Biological function summary

IgA2 serves as an essential component of the mucosal immune system. It forms complexes with antigenic substances to neutralize pathogens and prevent their adherence to epithelial cells. The dimeric form of IgA2 combined with the secretory component allows it to be effectively transported across mucosal barriers into secretions where it functions without activating complement pathways therefore reducing inflammation. The secretory IgA2 forms a physical barrier on mucosal surfaces trapping microbes and toxins.

Pathways

IgA2 functions within the mucosal immune response pathways and plays an important interaction role with components of the adaptive immune response. It associates with the polymeric immunoglobulin receptor (pIgR) facilitating its transcytosis across epithelial cells into secretions. IgA2 also operates within the immunological network alongside J chain proteins instrumental in forming its dimeric structure important for appropriate secretion and function in mucosal immunity.

IgA2 is connected to immunological conditions like IgA nephropathy and selective IgA deficiency. IgA nephropathy involves deposits of IgA in the kidneys which can lead to inflammatory kidney damage. In selective IgA deficiency individuals may have increased susceptibility to infections at mucosal surfaces due to decreased IgA levels wherein IgA2's role is significant. The interaction of IgA2 with other immunoglobulins becomes a factor in assessing these diseases especially with proteins that influence the immune response's regulation.

Specifications

Form

Liquid

General info

Function

Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed : 20176268, PubMed : 22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed : 17576170, PubMed : 20176268). Ig alpha is the major immunoglobulin class in body secretions (PubMed : 2241915).

Product protocols

Target data

Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed : 20176268, PubMed : 22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed : 17576170, PubMed : 20176268). Ig alpha is the major immunoglobulin class in body secretions (PubMed : 2241915).
See full target information IGHA2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com