JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276738

Recombinant Human IgE protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IgE protein (His tag) is a Human Fragment protein, in the 208 to 427 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Immunoglobulin heavy constant epsilon, Ig epsilon chain C region, Ig epsilon chain C region ND, IGHE

1 Images
SDS-PAGE - Recombinant Human IgE protein (His tag) (AB276738)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IgE protein (His tag) (AB276738)

SDS-PAGE analysis of ab276738

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P01854

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"CADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK","proteinLength":"Fragment","predictedMolecularWeight":"26 kDa","actualMolecularWeight":null,"aminoAcidEnd":427,"aminoAcidStart":208,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01854","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The IgE protein [also known as immunoglobulin E] is a type of antibody with a molecular mass of approximately 190 kDa. IgE is expressed primarily on the surface of mast cells and basophils. It plays a central role in the immune system by binding to allergens and triggering the release of inflammatory mediators from mast cells and basophils. IgE's high-affinity binding to its receptor FcεRI on these effector cells facilitates this process. IgE's activity is central to initiating immediate hypersensitivity reactions which are a part of the body's immune response.
Biological function summary

The IgE protein functions as a mediator in allergic reactions. It does not operate as part of a complex but directly interacts with allergens and the IgE-specific receptors on immune cells. IgE's role is important in defense against parasitic infections where it performs a protective function by promoting eosinophil activation and degranulation. This action helps the body to expel the parasites. In the absence of parasitic infection IgE's function translates into its role in allergic responses where it becomes responsible for the symptoms associated with allergic diseases.

Pathways

IgE is an important player in the immune response pathway. The protein interacts with allergy-related pathways such as the T helper 2 (Th2) pathway. IgE's role in this pathway involves cooperation with cytokines notably IL-4 and IL-13 which are produced by Th2 cells and promote IgE synthesis in B cells. Also IgE is linked to the FcεRI receptor signaling pathway that initiates the release of histamines and other mediators when IgE binds to an allergen leading to an allergic response.

IgE is closely linked to allergic conditions like asthma and allergic rhinitis. These conditions result from IgE-mediated inflammatory responses that affect the respiratory system. In asthma IgE antibodies play a role in airway inflammation and hyperreactivity by promoting the activation of multiple immune cells including eosinophils and mast cells. IgE's involvement in allergic rhinitis manifests through similar mechanisms with nasal inflammation and irritation. IgE's interaction with other proteins such as histamine-releasing factor exacerbates these conditions by increasing the release of histamine which intensifies the allergic symptoms.

Specifications

Form

Lyophilized

General info

Function

Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed : 20176268, PubMed : 22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed : 17576170, PubMed : 20176268).. Isoform 1. Constant region of secreted IgE, also known as the Fc region of IgE antibody. Mediates IgE effector functions on myeloid and lymphoid cells primarily via two Fc receptors, the high-affinity IgE Fc receptor complex/FCER1A : MS4A2 : FCGR1A and the low-affinity FCER2 receptor, which upon antigen/allergen cross-linking initiate signaling pathways that lead to immune cell activation and differentiation (PubMed : 2167225, PubMed : 25629393, PubMed : 33840121, PubMed : 7544003, PubMed : 8114916, PubMed : 8551243). Triggers the immediate hypersensitivity response to allergens as a host defense mechanism against helminth parasites, pathogenic bacteria and venom toxicity. When dysregulated, it can elicit harmful life-threatening allergic and anaphylactic reactions (PubMed : 25629393, PubMed : 33840121, PubMed : 7544003, PubMed : 8114916, PubMed : 8551243). Stimulates the high-affinity IgE Fc receptor complex/FCER1A : MS4A2 : FCGR1A on mast cells, basophils and eosinophils leading to secretion of vasoactive amines, lipid mediators and cytokines that contribute to inflammatory response, tissue remodeling and cytotoxicity against microbes (PubMed : 25629393, PubMed : 8114916, PubMed : 8551243). On macrophages, cross-linking of FCER2 by IgE immune complexes induces intracellular killing of parasites through activation of L-Arginine-nitric oxide pathway (PubMed : 7544003). Activates macrophages to kill tumor cells via antigen-specific antibody-dependent cytotoxicity (ADCC). Triggers differentiation of quiescent M0 macrophages toward M1 state and reprograms M2 macrophages toward a proinflammatory state with antitumor functions (PubMed : 30956175). Stimulates FCER2 on B cells and initiates IgE-dependent antigen uptake and presentation to T cells (PubMed : 2167225).. Isoform 2. Constant region of membrane-bound IgE (long mIgE), part of the B cell receptor complex (BCR). Upon antigen cross-linking triggers quick BCR signaling, ensuring survival of IgE-switched B cells and differentiation into plasma cells, thus regulating both primary and memory IgE responses.. Isoform 3. Constant region of membrane-bound IgE (short mIgE), part of the B cell receptor complex (BCR). Upon antigen cross-linking initiates slower but sustained BCR signaling that negatively regulates mature B cell proliferation.

Product protocols

Target data

Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed : 20176268, PubMed : 22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed : 17576170, PubMed : 20176268).. Isoform 1. Constant region of secreted IgE, also known as the Fc region of IgE antibody. Mediates IgE effector functions on myeloid and lymphoid cells primarily via two Fc receptors, the high-affinity IgE Fc receptor complex/FCER1A : MS4A2 : FCGR1A and the low-affinity FCER2 receptor, which upon antigen/allergen cross-linking initiate signaling pathways that lead to immune cell activation and differentiation (PubMed : 2167225, PubMed : 25629393, PubMed : 33840121, PubMed : 7544003, PubMed : 8114916, PubMed : 8551243). Triggers the immediate hypersensitivity response to allergens as a host defense mechanism against helminth parasites, pathogenic bacteria and venom toxicity. When dysregulated, it can elicit harmful life-threatening allergic and anaphylactic reactions (PubMed : 25629393, PubMed : 33840121, PubMed : 7544003, PubMed : 8114916, PubMed : 8551243). Stimulates the high-affinity IgE Fc receptor complex/FCER1A : MS4A2 : FCGR1A on mast cells, basophils and eosinophils leading to secretion of vasoactive amines, lipid mediators and cytokines that contribute to inflammatory response, tissue remodeling and cytotoxicity against microbes (PubMed : 25629393, PubMed : 8114916, PubMed : 8551243). On macrophages, cross-linking of FCER2 by IgE immune complexes induces intracellular killing of parasites through activation of L-Arginine-nitric oxide pathway (PubMed : 7544003). Activates macrophages to kill tumor cells via antigen-specific antibody-dependent cytotoxicity (ADCC). Triggers differentiation of quiescent M0 macrophages toward M1 state and reprograms M2 macrophages toward a proinflammatory state with antitumor functions (PubMed : 30956175). Stimulates FCER2 on B cells and initiates IgE-dependent antigen uptake and presentation to T cells (PubMed : 2167225).. Isoform 2. Constant region of membrane-bound IgE (long mIgE), part of the B cell receptor complex (BCR). Upon antigen cross-linking triggers quick BCR signaling, ensuring survival of IgE-switched B cells and differentiation into plasma cells, thus regulating both primary and memory IgE responses.. Isoform 3. Constant region of membrane-bound IgE (short mIgE), part of the B cell receptor complex (BCR). Upon antigen cross-linking initiates slower but sustained BCR signaling that negatively regulates mature B cell proliferation.
See full target information IGHE

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com