JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB155614

Recombinant human IGF1 protein (Active)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human IGF1 protein (Active) is a Human Fragment protein, in the 49 to 118 aa range, expressed in HEK 293 cells, with >98%, < 1 EU/µg endotoxin level, suitable for ELISA, SDS-PAGE, FuncS.

View Alternative Names

IBP1, IGF-1, IGF1, Insulin-like growth factor 1, Insulin-like growth factor I, Mechano growth factor, Somatomedin-C, IGF-I, MGF

3 Images
Functional Studies - Recombinant human IGF1 protein (Active) (AB155614)
  • FuncS

Supplier Data

Functional Studies - Recombinant human IGF1 protein (Active) (AB155614)

Immobilized Human IGF-I R, His Tag (ab155622) at 5 μg/mL (100 μL/well) can bind Recombinant human IGF1 protein (Active) (ab155614) with a linear range of 0.039-0.313 μg/mL.

Functional Studies - Recombinant human IGF1 protein (Active) (AB155614)
  • FuncS

Supplier Data

Functional Studies - Recombinant human IGF1 protein (Active) (AB155614)

Immobilized Recombinant human IGF1 protein (Active) (ab155614) at 5 μg/mL (100 μL/well) can bind Recombinant Human IGFBP3 protein (ab155611) with a linear range of 0.031-0.5 μg/mL.

SDS-PAGE - Recombinant human IGF1 protein (Active) (AB155614)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human IGF1 protein (Active) (AB155614)

SDS-PAGE of reduced ab155614 stained overnight with Coomassie Blue.

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag N-Terminus

Applications

ELISA, SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA. Immobilized Human IGF-I R, His Tag (ab155622) at 5 μg/mL (100 μL/well) can bind Human IGF-I, Fc Tag (ab155614) with a linear range of 0.039-0.313 μg/mL.

Measured by its binding ability in a functional ELISA. Immobilized Recombinant human IGF1 protein (Active) (ab155614) at 5 μg/mL (100 μL/well) can bind Recombinant Human IGFBP3 protein (ab155611) with a linear range of 0.031-0.5 μg/mL.

Accession

P05019

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 400 µg/mL in water

Storage buffer

pH: 7.4 Constituents: 0.75% Glycine, 0.605% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>The protein migrates as 40 kDa under reducing conditions.</p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA","proteinLength":"Fragment","predictedMolecularWeight":"34.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":118,"aminoAcidStart":49,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P05019","tags":[{"tag":"Fc","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The insulin-like growth factor 1 or IGF1 is a protein hormone that plays an important mechanical role in growth and development. Alternative names for IGF1 include somatomedin C. This protein has a mass of approximately 7.6 kDa and is mainly produced by the liver. IGF1 is expressed in a range of tissues including muscle bone and cartilage reflecting its importance in various physiological processes. Its production is stimulated by growth hormone and it acts in an autocrine and paracrine manner to exert its effects.
Biological function summary

IGF1 stimulates growth and proliferation of cells most notably impacting the development of the skeletal system and the regulation of apoptosis. It is not part of a larger protein complex but it interacts closely with IGF1 receptor to execute its functions. By binding to this receptor IGF1 activates intracellular signaling cascades that promote anabolic effects which include increased uptake of glucose and amino acids contributing to muscle and tissue growth.

Pathways

IGF1 operates within the PI3K-Akt and MAPK signaling pathways which are significant for cell survival and proliferation. Its interaction with proteins like IGF binding protein 3 (IGFBP3) modulates its availability and activity in the bloodstream. These pathways are critical for mediating the effects of growth hormone highlighting the role of IGF1 in systemic growth and metabolism regulation.

Alterations in IGF1 levels associate with growth abnormalities such as Laron syndrome and acromegaly. Laron syndrome results from the body's inability to use IGF1 properly due to receptor defects while acromegaly occurs from excessive IGF1 production often due to pituitary tumors. Furthermore aberrant IGF1 signaling connects to cancer development where it can drive tumor growth and metastasis. Drugs targeting IGF1 and its pathway components continue to be researched for therapeutic potential in these conditions.

Specifications

Form

Lyophilized

Additional notes

Lyophilized from 0.22µm filtered solution

General info

Function

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation (PubMed : 21076856, PubMed : 24132240). Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb (By similarity). Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV : ITGB3 and ITGA6 : ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed : 19578119, PubMed : 22351760, PubMed : 23243309, PubMed : 23696648). As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity).

Sequence similarities

Belongs to the insulin family.

Product protocols

Target data

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation (PubMed : 21076856, PubMed : 24132240). Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb (By similarity). Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV : ITGB3 and ITGA6 : ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed : 19578119, PubMed : 22351760, PubMed : 23243309, PubMed : 23696648). As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity).
See full target information IGF1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Stem cell research & therapy 10:343 PubMed31753006

2019

The factors present in regenerating muscles impact bone marrow-derived mesenchymal stromal/stem cell fusion with myoblasts.

Applications

Unspecified application

Species

Unspecified reactive species

Paulina Kasprzycka,Karolina Archacka,Kamil Kowalski,Bartosz Mierzejewski,Małgorzata Zimowska,Iwona Grabowska,Mariusz Piotrowski,Milena Rafałko,Agata Ryżko,Aliksandra Irhashava,Kamil Senderowski,Magdalena Gołąbek,Władysława Stremińska,Katarzyna Jańczyk-Ilach,Marta Koblowska,Roksana Iwanicka-Nowicka,Anna Fogtman,Mirosław Janowski,Piotr Walczak,Maria A Ciemerych,Edyta Brzoska
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com