JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB270062

Recombinant human IGF1 protein (Active)

5

(1 Review)

|

(9 Publications)

Recombinant human IGF1 protein (Active) is a Human Full Length protein in the 49 to 118 aa range with ≥95% purity, < 0.005 EU/µg endotoxin level and suitable for SDS-PAGE, Functional studies, Cell Culture, mass spectrometry and HPLC. The predicted molecular weight of ab270062 protein is 7.7 kDa.

- Save time and ensure accurate results - use our human Insulin-like growth factor I (IGF-1) protein as a control
- Optimal protein bioactivity and stability
- Available in different sizes to fit your experimental needs

View Alternative Names

IBP1, IGF-1, IGF1, Insulin-like growth factor 1, Insulin-like growth factor I, Mechano growth factor, Somatomedin-C, IGF-I, MGF

4 Images
Functional Studies - Recombinant human IGF1 protein (Active) (AB270062)
  • FuncS

Lab

Functional Studies - Recombinant human IGF1 protein (Active) (AB270062)

Fully biologicaly active as determined by dose-depended proliferation of MCF-7 cells. The ED50 is ≤ 0.9 ng/mL, corresponding to a specific activity of 1.11 x 106 units/mg.

Mass Spectrometry - Recombinant human IGF1 protein (Active) (AB270062)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant human IGF1 protein (Active) (AB270062)

M - 2.84 Da (Calculated mass 7711.84 Da)

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

SDS-PAGE - Recombinant human IGF1 protein (Active) (AB270062)
  • SDS-PAGE

Lab

SDS-PAGE - Recombinant human IGF1 protein (Active) (AB270062)

SDS-PAGE analysis of ab270062.

HPLC - Recombinant human IGF1 protein (Active) (AB270062)
  • HPLC

Lab

HPLC - Recombinant human IGF1 protein (Active) (AB270062)

Purity ≥95%

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, HPLC, FuncS, Cell Culture, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologicaly active as determined by dose-depended proliferation of MCF-7 cells.

ED50 is ≤ 0.9 ng/mL, corresponding to a specific activity of 1.11 x 106 units/mg.

Accession

P05019

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our recombinant human IGF1 protein ab270062 as a control.

The ab270062 IGF-1 protein is sourced from HEK293 cells and can be used as a positive control in SDS-PAGE, mass spectrometry and HPLC.

Check out our protein gel staining guide for SDS-PAGE here

Premium Bioactive Protein range

The ab270062 IGF-1 protein is part of the premium bioactive protein range which are ideal for preclinical cell culture and functional studies. These recombinant proteins are of the highest activity, purity, and consistency, meeting rigorous biophysical characterization.

More premium bioactive proteins can be found here

Sequence info

[{"sequence":"GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA","proteinLength":"Full Length","predictedMolecularWeight":"7.71 kDa","actualMolecularWeight":null,"aminoAcidEnd":118,"aminoAcidStart":49,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P05019","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The insulin-like growth factor 1 or IGF1 is a protein hormone that plays an important mechanical role in growth and development. Alternative names for IGF1 include somatomedin C. This protein has a mass of approximately 7.6 kDa and is mainly produced by the liver. IGF1 is expressed in a range of tissues including muscle bone and cartilage reflecting its importance in various physiological processes. Its production is stimulated by growth hormone and it acts in an autocrine and paracrine manner to exert its effects.
Biological function summary

IGF1 stimulates growth and proliferation of cells most notably impacting the development of the skeletal system and the regulation of apoptosis. It is not part of a larger protein complex but it interacts closely with IGF1 receptor to execute its functions. By binding to this receptor IGF1 activates intracellular signaling cascades that promote anabolic effects which include increased uptake of glucose and amino acids contributing to muscle and tissue growth.

Pathways

IGF1 operates within the PI3K-Akt and MAPK signaling pathways which are significant for cell survival and proliferation. Its interaction with proteins like IGF binding protein 3 (IGFBP3) modulates its availability and activity in the bloodstream. These pathways are critical for mediating the effects of growth hormone highlighting the role of IGF1 in systemic growth and metabolism regulation.

Alterations in IGF1 levels associate with growth abnormalities such as Laron syndrome and acromegaly. Laron syndrome results from the body's inability to use IGF1 properly due to receptor defects while acromegaly occurs from excessive IGF1 production often due to pituitary tumors. Furthermore aberrant IGF1 signaling connects to cancer development where it can drive tumor growth and metastasis. Drugs targeting IGF1 and its pathway components continue to be researched for therapeutic potential in these conditions.

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC >=95%.

General info

Function

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation (PubMed : 21076856, PubMed : 24132240). Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb (By similarity). Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV : ITGB3 and ITGA6 : ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed : 19578119, PubMed : 22351760, PubMed : 23243309, PubMed : 23696648). As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity).

Sequence similarities

Belongs to the insulin family.

Product protocols

Target data

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation (PubMed : 21076856, PubMed : 24132240). Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb (By similarity). Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV : ITGB3 and ITGA6 : ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed : 19578119, PubMed : 22351760, PubMed : 23243309, PubMed : 23696648). As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity).
See full target information IGF1

Publications (9)

Recent publications for all applications. Explore the full list and refine your search

Stem cell research & therapy 15:4 PubMed38167128

2024

Genetic correction of induced pluripotent stem cells from a DFNA36 patient results in morphologic and functional recovery of derived hair cell-like cells.

Applications

Unspecified application

Species

Unspecified reactive species

Yi Luo,Kaiwen Wu,Xiaolong Zhang,Hongyang Wang,Qiuju Wang

FASEB journal : official publication of the Federation of American Societies for Experimental Biology 37:e22935 PubMed37086094

2023

MiR-24-3p regulates the differentiation of adipose-derived stem cells toward pericytes and promotes fat grafting vascularization.

Applications

Unspecified application

Species

Unspecified reactive species

Zhongming Cai,Zihao Li,Qing Wei,Fangfang Yang,Tian Li,Chen Ke,Yucang He,Jingping Wang,Binting Ni,Ming Lin,Liqun Li

Veterinary research communications 47:1523-1533 PubMed37036601

2023

The effects of apelin on IGF1/FSH-induced steroidogenesis, proliferation, Bax expression, and total antioxidant capacity in granulosa cells of buffalo ovarian follicles.

Applications

Unspecified application

Species

Unspecified reactive species

Borhan Shokrollahi,Hai-Ying Zheng,Xiao-Ya Ma,Jiang-Hua Shang

Cells 12: PubMed36766747

2023

Phosphorylation of IGFBP-3 by Casein Kinase 2 Blocks Its Interaction with Hyaluronan, Enabling HA-CD44 Signaling Leading to Increased NSCLC Cell Survival and Cisplatin Resistance.

Applications

Unspecified application

Species

Unspecified reactive species

Kai-Ling Coleman,Michael Chiaramonti,Ben Haddad,Robert Ranzenberger,Heather Henning,Hind Al Khashali,Ravel Ray,Ban Darweesh,Jeffrey Guthrie,Deborah Heyl,Hedeel Guy Evans

Nature communications 13:5500 PubMed36127359

2022

Structure of the PAPP-A complex reveals mechanism of substrate recognition.

Applications

Unspecified application

Species

Unspecified reactive species

Russell A Judge,Janani Sridar,Kathryn Tunyasuvunakool,Rinku Jain,John C K Wang,Christna Ouch,Jun Xu,Amirhossein Mafi,Aaron H Nile,Clint Remarcik,Corey L Smith,Crystal Ghosh,Chen Xu,Vincent Stoll,John Jumper,Amoolya H Singh,Dan Eaton,Qi Hao

Journal of nanobiotechnology 20:315 PubMed35794573

2022

IGF1 receptor-targeted black TiO nanoprobes for MRI-guided synergetic photothermal-chemotherapy in drug resistant pancreatic tumor.

Applications

Unspecified application

Species

Unspecified reactive species

Kaiwei Xu,Lufei Jin,Liu Xu,Yuchao Zhu,Lu Hong,Chunshu Pan,Yanying Li,Junlie Yao,Ruifen Zou,Weiwei Tang,Jianhua Wang,Aiguo Wu,Wenzhi Ren

Journal of cellular and molecular medicine 26:2881-2894 PubMed35415942

2022

Effect of Glut-1 and HIF-1α double knockout by CRISPR/CAS9 on radiosensitivity in laryngeal carcinoma via the PI3K/Akt/mTOR pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Yang-Yang Bao,Jiang-Tao Zhong,Li-Fang Shen,Li-Bo Dai,Shui-Hong Zhou,Jun Fan,Hong-Tian Yao,Zhong-Jie Lu

Frontiers in endocrinology 13:844360 PubMed35355567

2022

Apelin and Apelin Receptor in Follicular Granulosa Cells of Buffalo Ovaries: Expression and Regulation of Steroidogenesis.

Applications

Unspecified application

Species

Unspecified reactive species

Borhan Shokrollahi,Hai-Ying Zheng,Ling-Yu Li,Li-Ping Tang,Xiao-Ya Ma,Xing-Rong Lu,An-Qin Duan,Yu Zhang,Xiao-Hui Tan,Chen-Xi Huang,Yuan-Yuan Xu,Jiang-Hua Shang

Cancer cell international 22:13 PubMed34996459

2022

Hypoxia-mediated YTHDF2 overexpression promotes lung squamous cell carcinoma progression by activation of the mTOR/AKT axis.

Applications

Unspecified application

Species

Unspecified reactive species

Peng Xu,Kang Hu,Ping Zhang,Zhi-Gang Sun,Nan Zhang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com