JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB9573

Recombinant human IGF1 protein (Active)

Be the first to review this product! Submit a review

|

(6 Publications)

Recombinant human IGF1 protein (Active) is a Human Fragment protein, in the 49 to 118 aa range, expressed in Escherichia coli, with >98%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, HPLC.

View Alternative Names

IBP1, IGF-1, IGF1, Insulin-like growth factor 1, Insulin-like growth factor I, Mechano growth factor, Somatomedin-C, IGF-I, MGF

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS, SDS-PAGE, HPLC

applications

Biologically active

Yes

Biological activity

The ED50, as determined by a cell proliferation assay using FDC-P1 cells, is ≤ 2.0 ng/ml, corresponding to a specific activity of ≥ 5 x 105 units/mg.

Accession

P05019

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute with 100 ul of deionised water (or equivalent Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA","proteinLength":"Fragment","predictedMolecularWeight":"7.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":118,"aminoAcidStart":49,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P05019","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The insulin-like growth factor 1 or IGF1 is a protein hormone that plays an important mechanical role in growth and development. Alternative names for IGF1 include somatomedin C. This protein has a mass of approximately 7.6 kDa and is mainly produced by the liver. IGF1 is expressed in a range of tissues including muscle bone and cartilage reflecting its importance in various physiological processes. Its production is stimulated by growth hormone and it acts in an autocrine and paracrine manner to exert its effects.
Biological function summary

IGF1 stimulates growth and proliferation of cells most notably impacting the development of the skeletal system and the regulation of apoptosis. It is not part of a larger protein complex but it interacts closely with IGF1 receptor to execute its functions. By binding to this receptor IGF1 activates intracellular signaling cascades that promote anabolic effects which include increased uptake of glucose and amino acids contributing to muscle and tissue growth.

Pathways

IGF1 operates within the PI3K-Akt and MAPK signaling pathways which are significant for cell survival and proliferation. Its interaction with proteins like IGF binding protein 3 (IGFBP3) modulates its availability and activity in the bloodstream. These pathways are critical for mediating the effects of growth hormone highlighting the role of IGF1 in systemic growth and metabolism regulation.

Alterations in IGF1 levels associate with growth abnormalities such as Laron syndrome and acromegaly. Laron syndrome results from the body's inability to use IGF1 properly due to receptor defects while acromegaly occurs from excessive IGF1 production often due to pituitary tumors. Furthermore aberrant IGF1 signaling connects to cancer development where it can drive tumor growth and metastasis. Drugs targeting IGF1 and its pathway components continue to be researched for therapeutic potential in these conditions.

Specifications

Form

Lyophilized

Additional notes

>98% HPLC analyses.

General info

Function

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation (PubMed : 21076856, PubMed : 24132240). Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb (By similarity). Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV : ITGB3 and ITGA6 : ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed : 19578119, PubMed : 22351760, PubMed : 23243309, PubMed : 23696648). As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity).

Sequence similarities

Belongs to the insulin family.

Product protocols

Target data

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation (PubMed : 21076856, PubMed : 24132240). Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb (By similarity). Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV : ITGB3 and ITGA6 : ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed : 19578119, PubMed : 22351760, PubMed : 23243309, PubMed : 23696648). As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity).
See full target information IGF1

Publications (6)

Recent publications for all applications. Explore the full list and refine your search

Infectious agents and cancer 18:22 PubMed37081537

2023

Brassicasterol inhibits hepatitis B virus-associated hepatocellular carcinoma development via suppression of AKT signaling pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Jindi Zeng,Jiancheng Wu,Shuijiao Pang,Feifei Wang,Xin Yu,Shouhua Zhang,Junquan Zeng,Jinlong Yan,Jianping Lian

Acta naturae 13:69-77 PubMed35127149

2022

The Different Impact of ERK Inhibition on Neuroblastoma, Astrocytoma, and Rhabdomyosarcoma Cell Differentiation.

Applications

Unspecified application

Species

Unspecified reactive species

T D Lebedev,E R Vagapova,V S Prassolov

FASEB journal : official publication of the Federa 34:5363-5388 PubMed32067272

2020

IPF pathogenesis is dependent upon TGFβ induction of IGF-1.

Applications

Unspecified application

Species

Unspecified reactive species

Danielle M Hernandez,Jeong-Han Kang,Malay Choudhury,Mahefatiana Andrianifahanana,Xueqian Yin,Andrew H Limper,Edward B Leof

Translational cancer research 8:2593-2601 PubMed35117016

2019

STAT3 activation regulated circ-STAT3.46 promote expression of IGF1R by sponging of miR-139-5p in human colon cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Yaxiang Shi,Xuan Chen,Biao Xi,Yucheng Qin,Lingjuan Sun,Jianhui Hu,Jingxuan Xu,Xiaowen Yu,Jun Ouyang,Ling Wei

International journal of cancer 145:2827-2839 PubMed31381136

2019

Paracrine recruitment and activation of fibroblasts by c-Myc expressing breast epithelial cells through the IGFs/IGF-1R axis.

Applications

Unspecified application

Species

Unspecified reactive species

Anna De Vincenzo,Stefania Belli,Paola Franco,Marialucia Telesca,Ingram Iaccarino,Gerardo Botti,Maria V Carriero,Marie Ranson,Maria Patrizia Stoppelli

Molecular medicine reports 20:2812-2822 PubMed31322233

2019

The role of Zeb1 in the pathogenesis of morbidly adherent placenta.

Applications

Unspecified application

Species

Unspecified reactive species

Na Li,Tian Yang,Wenqian Yu,Hao Liu,Chong Qiao,Caixia Liu
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com