JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB283420

Recombinant Human IGF2 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IGF2 protein (Active) is a Human Fragment protein, in the 25 to 91 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, HPLC, Biological Activity, Cell Culture, FuncS.

View Alternative Names

IGF-2, PP1446, IGF2, Insulin-like growth factor 2, Insulin-like growth factor II, Somatomedin-A, T3M-11-derived growth factor, IGF-II

5 Images
Functional Studies - Recombinant Human IGF2 protein (Active) (AB283420)
  • FuncS

Lab

Functional Studies - Recombinant Human IGF2 protein (Active) (AB283420)

Fully biologically active determined by dose dependent proliferation of MCF7 cell. ED50 is ≤ 5.8 ng/ml, corresponding to a specific activity of 1.72x10^5 units/mg. Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot. Lot GR3430138-1

Biological Activity - Recombinant Human IGF2 protein (Active) (AB283420)
  • Biological Activity

Supplier Data

Biological Activity - Recombinant Human IGF2 protein (Active) (AB283420)

Functional analysis of ab283420.

Fully biologically active determined by the dose dependent proliferation of MCF7 cells. ED50 is ≤5.8 ng/mL, corresponding to a specific activity of 1.72 x 105 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot GR3430138-2

Mass Spectrometry - Recombinant Human IGF2 protein (Active) (AB283420)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human IGF2 protein (Active) (AB283420)

Mass determination by ESI-TOF.

Predicted MW is 7532.52 (+/- 10Da by ESI-TOF). MW observed 7532.89.

SDS-PAGE - Recombinant Human IGF2 protein (Active) (AB283420)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IGF2 protein (Active) (AB283420)

SDS-PAGE analysis of ab283420.

HPLC - Recombinant Human IGF2 protein (Active) (AB283420)
  • HPLC

Supplier Data

HPLC - Recombinant Human IGF2 protein (Active) (AB283420)

HPLC analysis of ab283420.

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Cell Culture, Mass Spec, FuncS, HPLC, Biological Activity, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of MCF7 cells. ED50 is ≤5.8 ng/mL, corresponding to a specific activity of 1.72 x 105 units/mg.

Accession

P01344

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Biological Activity": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"" } } }

Sequence info

[{"sequence":"AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE","proteinLength":"Fragment","predictedMolecularWeight":"20 kDa","actualMolecularWeight":null,"aminoAcidEnd":91,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01344","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

General info

Function

The insulin-like growth factors possess growth-promoting activity (By similarity). Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). Acts as a ligand for integrin which is required for IGF2 signaling (PubMed : 28873464). Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity). Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate (By similarity).. Preptin undergoes glucose-mediated co-secretion with insulin, and acts as a physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.

Sequence similarities

Belongs to the insulin family.

Post-translational modifications

O-glycosylated with core 1 or possibly core 8 glycans. Thr-96 is a minor glycosylation site compared to Thr-99.. Proteolytically processed by PCSK4, proIGF2 is cleaved at Arg-128 and Arg-92 to generate big-IGF2 and mature IGF2.

Product protocols

Target data

The insulin-like growth factors possess growth-promoting activity (By similarity). Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). Acts as a ligand for integrin which is required for IGF2 signaling (PubMed : 28873464). Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity). Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate (By similarity).. Preptin undergoes glucose-mediated co-secretion with insulin, and acts as a physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.
See full target information IGF2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com