JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB316087

Recombinant Human IgG1 Fc (Active) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IgG1 Fc (Active) protein is a Human Fragment protein, in the 104 to 330 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, SPR, HPLC, FuncS.

View Alternative Names

Immunoglobulin heavy constant gamma 1, Ig gamma-1 chain C region, Ig gamma-1 chain C region EU, Ig gamma-1 chain C region KOL, Ig gamma-1 chain C region NIE, IGHG1

3 Images
HPLC - Recombinant Human IgG1 Fc (Active) protein (AB316087)
  • HPLC

Lab

HPLC - Recombinant Human IgG1 Fc (Active) protein (AB316087)

The purity of Human IgG1 Fc, ab316087, is greater than 95% as determined by SEC-HPLC.

SDS-PAGE - Recombinant Human IgG1 Fc (Active) protein (AB316087)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IgG1 Fc (Active) protein (AB316087)

Human IgG1 Fc, ab316087, on Bis-Tris PAGE under reduced condition. The purity is greater than 95%.

Surface Plasmon Resonance - Recombinant Human IgG1 Fc (Active) protein (AB316087)
  • SPR

Supplier Data

Surface Plasmon Resonance - Recombinant Human IgG1 Fc (Active) protein (AB316087)

Human FcRn, His Tag captured on CM5 Chip via anti-his antibody can bind ab316087, Human IgG1 Fc, No Tag with an affinity constant of 0.28 uM as determined in SPR assay.

Key facts

Purity

>95% HPLC

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SPR, HPLC, SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Human FcRn, His Tag captured on CM5 Chip via anti-his antibody can bind Human IgG1 Fc, No Tag with an affinity constant of 0.28 uM as determined in SPR assay.

Accession

P01857

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water.

Storage buffer

Constituents: PBS, 8% Trehalose

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SPR": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK","proteinLength":"Fragment","predictedMolecularWeight":"25.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":330,"aminoAcidStart":104,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01857","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage duration
A few days
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C|-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Specifications

Form

Lyophilized

General info

Function

Constant region of immunoglobulin (Ig) heavy chains. Igs are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound Igs serve as receptors, which upon binding to a specific antigen trigger the clonal expansion and differentiation of B lymphocytes into Ig-secreting plasma cells. Secreted Igs known as antibodies mediate the effector phase of humoral immunity by blocking the interaction of infectious antigens with cellular receptors (via the antigen-binding region) and eliciting effector mechanisms that lead to pathogen neutralization (via the constant region) (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The antigen-binding region is formed by the variable domain of one heavy chain paired with the variable domain of its associated light chain. Each Ig molecule has two antigen-binding sites with remarkable affinity for a particular antigen due to V-(D)-J rearrangement, somatic hypermutations and affinity maturation of the variable domains upon antigen exposure (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The constant region defines the Ig isotype that perform distinct sets of effector functions. B cells diversify and rearrange their Ig constant regions through class-switch recombination, a process by which the constant region is switched from one Ig isotype to another, namely from IgM and IgD to IgG, IgA and IgE (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The constant region of Ig gamma-1 (IgG1) isotype interacts (via the fragment crystallizable, Fc) with receptors on innate immune cells and the complement system to mediate humoral effector functions, including antibody-dependent cellular cytotoxicity or phagocytosis, complement-dependent cytotoxicity and inflammatory responses.

Post-translational modifications

N-glycosylated. Carries predominantly biantennary complex-type glycans attached at Asn-180 residue on the Fc region of each heavy chain. Unique Fc glycan profiles found in secreted IgGs are induced in an antigen-specific way, likely programmed during B cell priming to mount an appropriate Ig effector response (PubMed:10818239, PubMed:10917521, PubMed:21768335, PubMed:22184099, PubMed:25561553, PubMed:29133956, PubMed:29445378). The core glycan is composed of two sequential N-acetylglucosamine (GlcNAc) moieties followed by a central mannose (Man) from which two additional Man residues branch out (alpha1,3 and alpha1,6 antennae) each capped with a GlcNAc. Additional sugar molecules can be added to generate over 30 possible glycans. Such sugar modifications include the addition of one fucose at the initial GlcNAc, galactose (Gal) and sialic acid (Neu5Ac) residues at antennary GlcNAc or a bisecting GlcNAc to the core Man (PubMed:10818239, PubMed:22184099, PubMed:29133956, PubMed:38383719). Variable addition of sugars account for different IgG functional states associated with antibody-dependent cellular cytotoxicity or phagocytosis and inflammatory responses such as complement activation and cytokine secretion. Fc N-glycan diversity is further enhanced by asymmetric glycan pairing on the heavy chains (PubMed:10818239, PubMed:20357243, PubMed:22184099, PubMed:29133956). Fc N-glycan sialylation is linked to anti-inflammatory effects. It regulates Fc effector functions through conformational changes leading to preferential interaction with type II Fc receptors while reducing binding to type I Fc receptors. During plasmablast response, sialylated Fc domains within immune complexes signal via FCER2/CD23 and drive the selection of B cells with high affinity for antigen (PubMed:18420934, PubMed:22184099, PubMed:25733881, PubMed:26140596). Fc Igs carrying afucosylated N-glycans preferentially activate FCGR3A, antigen-dependent cellular cytotoxicity and antitumor immunity (PubMed:12427744, PubMed:21768335, PubMed:28566370, PubMed:30061887, PubMed:36867679).. (Microbial infection) Deglycosylation on Asn-180 by S. pyogenes EndoS or Endos2 endoglucosidases prevents interaction between immunoglobulin-gamma (IgG) and Fc receptors, impairing ability to activate the complement pathway.

Product protocols

Target data

Constant region of immunoglobulin (Ig) heavy chains. Igs are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound Igs serve as receptors, which upon binding to a specific antigen trigger the clonal expansion and differentiation of B lymphocytes into Ig-secreting plasma cells. Secreted Igs known as antibodies mediate the effector phase of humoral immunity by blocking the interaction of infectious antigens with cellular receptors (via the antigen-binding region) and eliciting effector mechanisms that lead to pathogen neutralization (via the constant region) (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The antigen-binding region is formed by the variable domain of one heavy chain paired with the variable domain of its associated light chain. Each Ig molecule has two antigen-binding sites with remarkable affinity for a particular antigen due to V-(D)-J rearrangement, somatic hypermutations and affinity maturation of the variable domains upon antigen exposure (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The constant region defines the Ig isotype that perform distinct sets of effector functions. B cells diversify and rearrange their Ig constant regions through class-switch recombination, a process by which the constant region is switched from one Ig isotype to another, namely from IgM and IgD to IgG, IgA and IgE (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The constant region of Ig gamma-1 (IgG1) isotype interacts (via the fragment crystallizable, Fc) with receptors on innate immune cells and the complement system to mediate humoral effector functions, including antibody-dependent cellular cytotoxicity or phagocytosis, complement-dependent cytotoxicity and inflammatory responses.
See full target information IGHG1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com