JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271549

Recombinant Human IgG4 protein (Fc)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IgG4 protein (Fc) is a Human Fragment protein, in the 99 to 327 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

Immunoglobulin heavy constant gamma 4, Ig gamma-4 chain C region, IGHG4

2 Images
Size Exclusion Chromatography - Recombinant Human IgG4 protein (Fc) (AB271549)
  • Size Exclusion Chromatography

Supplier Data

Size Exclusion Chromatography - Recombinant Human IgG4 protein (Fc) (AB271549)

SEC analysis of ab271549.

SDS-PAGE - Recombinant Human IgG4 protein (Fc) (AB271549)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IgG4 protein (Fc) (AB271549)

SDS-PAGE analysis of ab271549.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Fc tag

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P01861

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Protein may be diluted to ≥ 100 μg/ml in PBS + glycerol and stored at -80°C.

Sequence info

[{"sequence":"IEGRMDESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK","proteinLength":"Fragment","predictedMolecularWeight":"27 kDa","actualMolecularWeight":null,"aminoAcidEnd":327,"aminoAcidStart":99,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01861","tags":[{"tag":"Fc","terminus":""}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Constant region of immunoglobulin (Ig) heavy chains. Igs are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound Igs serve as receptors, which upon binding to a specific antigen trigger the clonal expansion and differentiation of B lymphocytes into Ig-secreting plasma cells. Secreted Igs known as antibodies mediate the effector phase of humoral immunity by blocking the interaction of infectious antigens with cellular receptors (via the antigen-binding region) and eliciting effector mechanisms that lead to pathogen neutralization (via the constant region) (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The antigen-binding region is formed by the variable domain of one heavy chain paired with the variable domain of its associated light chain. Each Ig molecule has two antigen-binding sites with remarkable affinity for a particular antigen due to V-(D)-J rearrangement, somatic hypermutations and affinity maturation of the variable domains upon antigen exposure (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The constant region defines the Ig isotype that perform distinct sets of effector functions. B cells diversify and rearrange their Ig constant regions through class-switch recombination, a process by which the constant region is switched from one Ig isotype to another, namely from IgM and IgD to IgG, IgA and IgE (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The constant region interacts (via the fragment crystallizable, Fc) with the Fc receptors on innate immune cells to mediate humoral effector functions. Ig gamma-4 (IgG4) isotype does not elicit antibody-dependent cellular cytotoxicity (ADDC) or complement-dependent cytotoxicity (CDC). Instead it is likely involved in immune tolerance mechanisms to allergens and parasites either by blocking IgE-antigen complex formation or by directly inhibiting mast cell degranulation through Fc receptor signaling. In the context of tumorigenesis, it may participate in immunosuppressive mechanisms.

Post-translational modifications

N-glycosylated. Carries predominantly biantennary complex-type glycans attached at Asn-177 residue on the Fc region of each heavy chain. Unique Fc glycan profiles found in secreted IgGs are induced in an antigen-specific way, likely programmed during B cell priming to mount an appropriate Ig effector response (PubMed:22184099, PubMed:28566370, PubMed:29133956). The core glycan is composed of two sequential N-acetylglucosamine (GlcNAc) moieties followed by a central mannose (Man) from which two additional Man residues branch out (alpha1,3 and alpha1,6 antennae) each capped with a GlcNAc. Additional sugar molecules can be added to generate over 30 possible glycans. Such sugar modifications include the addition of one fucose at the initial GlcNAc, galactose (Gal) and sialic acid (Neu5Ac) residues at antennary GlcNAc or a bisecting GlcNAc to the core Man (PubMed:22184099, PubMed:28566370, PubMed:29133956). Variable addition of sugars account for different IgG functional states associated with antibody-dependent cellular cytotoxicity or phagocytosis and inflammatory responses such as complement activation and cytokine secretion. Fc N-glycan diversity is further enhanced by asymmetric glycan pairing on the heavy chains (PubMed:22184099, PubMed:28566370, PubMed:29133956). Fc N-glycan sialylation is linked to anti-inflammatory effects. It regulates Fc effector functions through conformational changes leading to preferential interaction with type II Fc receptors while reducing binding to type I Fc receptors. During plasmablast response, sialylated Fc domains within immune complexes signal via FCER2/CD23 and drive the selection of B cells with high affinity for antigen (PubMed:22184099). Whereas afucosylated Fc N-glycan preferentially activate FCGR3A, antigen-dependent cellular cytotoxicity and antitumor immunity (PubMed:28566370).. (Microbial infection) Deglycosylation on Asn-177 by S.pyogenes EndoS or Endos2 endoglucosidases prevents interaction between immunoglobulin-gamma (IgG) and Fc receptors, impairing ability to activate the complement pathway.

Product protocols

Target data

Constant region of immunoglobulin (Ig) heavy chains. Igs are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound Igs serve as receptors, which upon binding to a specific antigen trigger the clonal expansion and differentiation of B lymphocytes into Ig-secreting plasma cells. Secreted Igs known as antibodies mediate the effector phase of humoral immunity by blocking the interaction of infectious antigens with cellular receptors (via the antigen-binding region) and eliciting effector mechanisms that lead to pathogen neutralization (via the constant region) (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The antigen-binding region is formed by the variable domain of one heavy chain paired with the variable domain of its associated light chain. Each Ig molecule has two antigen-binding sites with remarkable affinity for a particular antigen due to V-(D)-J rearrangement, somatic hypermutations and affinity maturation of the variable domains upon antigen exposure (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The constant region defines the Ig isotype that perform distinct sets of effector functions. B cells diversify and rearrange their Ig constant regions through class-switch recombination, a process by which the constant region is switched from one Ig isotype to another, namely from IgM and IgD to IgG, IgA and IgE (PubMed : 17576170, PubMed : 20176268, PubMed : 22158414). The constant region interacts (via the fragment crystallizable, Fc) with the Fc receptors on innate immune cells to mediate humoral effector functions. Ig gamma-4 (IgG4) isotype does not elicit antibody-dependent cellular cytotoxicity (ADDC) or complement-dependent cytotoxicity (CDC). Instead it is likely involved in immune tolerance mechanisms to allergens and parasites either by blocking IgE-antigen complex formation or by directly inhibiting mast cell degranulation through Fc receptor signaling. In the context of tumorigenesis, it may participate in immunosuppressive mechanisms.
See full target information IGHG4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com