JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB201399

Recombinant human Ihh protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Ihh protein is a Human Full Length protein, in the 29 to 202 aa range, expressed in Escherichia coli, with >96%, suitable for SDS-PAGE, FuncS, HPLC.

View Alternative Names

Indian hedgehog protein, IHH, HHG-2

Key facts

Purity

>96% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS, HPLC, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 3.0-10 μg/ml.

Accession

Q14623

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"IIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG","proteinLength":"Full Length","predictedMolecularWeight":"19.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":202,"aminoAcidStart":29,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q14623","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Indian hedgehog (Ihh) protein known by its gene symbol IHH plays key roles in cell signaling. Ihh with an approximate mass of 45 kDa belongs to the Hedgehog family of signaling molecules. It is expressed in various tissues including cartilage bone and parts of the gastrointestinal tract where it regulates growth and patterning. Ihh acts by binding to its receptor Patched triggering downstream signaling that influences cell fate decisions.
Biological function summary

Ihh is significant in regulating the differentiation and proliferation of chondrocytes in the growth plate of long bones. It acts as part of a complex regulatory network coordinating with Parathyroid hormone-related protein (PTHrP) to maintain proper development of endochondral bones. Ihh also influences epithelial and mesenchymal interactions during embryo development evidencing its important role in developmental biology.

Pathways

Ihh is a critical component of the Hedgehog signaling pathway a conserved pathway involved in embryonic development and adult tissue homeostasis. This pathway also includes proteins like Sonic hedgehog (Shh) and Desert hedgehog (Dhh) as well as the receptor Smoothened which mediates the signaling cascade. Ihh signaling impacts pathways such as the Wnt pathway influencing the proliferation and differentiation of cells thereby highlighting its integration into broader cellular signaling networks.

Ihh misregulation can lead to skeletal disorders like brachydactyly type A1 characterized by shortened fingers and toes. Furthermore abnormal Ihh signaling can contribute to certain cancers such as chondrosarcoma where overactive Hedgehog signaling promotes tumorigenesis. The relationship between Ihh and other Hedgehog proteins including Shh is key in understanding these pathologies as they share pathways that are often disrupted in disease scenarios.

Specifications

Form

Lyophilized

Additional notes

> 96 % by SDS-PAGE and HPLC.

General info

Function

Indian hedgehog protein. The C-terminal part of the indian hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). Both activities occur in the reticulum endoplasmic (By similarity). Plays a role in hedgehog paracrine signaling (PubMed : 24342078). Associated with the very-low-density lipoprotein (VLDL) particles to function as a circulating morphogen for endothelial cell integrity maintenance (PubMed : 20839884).. Indian hedgehog protein N-product. The dually lipidated indian hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development. Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (By similarity). Plays a role in morphogenesis of the skeleton by coordinating growth and differentiation of the endochondral skeleton (By similarity). Positively regulates PTHLH expression during endochondral bone formation preventing chondrocyte hypertrophy. In contrast, participates in normal chondrocyte proliferation in a PTHLH-independent pathway (By similarity).

Sequence similarities

Belongs to the hedgehog family.

Post-translational modifications

Indian hedgehog protein N-product. Cholesterylation is required for N-product targeting to lipid rafts and multimerization.. Indian hedgehog protein. The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). The N-product is the active species in both local and long-range signaling, whereas the C-product is degraded in the reticulum endoplasmic (By similarity).. Indian hedgehog protein N-product. N-palmitoylation by HHAT of N-product is required for indian hedgehog protein N-product multimerization and full activity.

Product protocols

Target data

Indian hedgehog protein. The C-terminal part of the indian hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). Both activities occur in the reticulum endoplasmic (By similarity). Plays a role in hedgehog paracrine signaling (PubMed : 24342078). Associated with the very-low-density lipoprotein (VLDL) particles to function as a circulating morphogen for endothelial cell integrity maintenance (PubMed : 20839884).. Indian hedgehog protein N-product. The dually lipidated indian hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development. Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (By similarity). Plays a role in morphogenesis of the skeleton by coordinating growth and differentiation of the endochondral skeleton (By similarity). Positively regulates PTHLH expression during endochondral bone formation preventing chondrocyte hypertrophy. In contrast, participates in normal chondrocyte proliferation in a PTHLH-independent pathway (By similarity).
See full target information IHH

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com