JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB280342

Recombinant human IL-1 alpha protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human IL-1 alpha protein (Active) is a Human Full Length protein, in the 113 to 271 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

View Alternative Names

IL1F1, IL1A, Interleukin-1 alpha, IL-1 alpha, Hematopoietin-1

4 Images
Mass Spectrometry - Recombinant human IL-1 alpha protein (Active) (AB280342)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human IL-1 alpha protein (Active) (AB280342)

Mass determination by ESI-TOF.

Predicted MW is 18104.62 Da (+/- 10 Da by ESI-TOF). Observed MW is 18106.40 Da.

Functional Studies - Recombinant human IL-1 alpha protein (Active) (AB280342)
  • FuncS

Supplier Data

Functional Studies - Recombinant human IL-1 alpha protein (Active) (AB280342)

Fully biologically active determined by the dose dependent increase in proliferation of D10.G4.1 cells.

ED50 for this effect is ≤2.51 ng/mL correspondng to a specific activity of 3.98/105 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3379471-1

SDS-PAGE - Recombinant human IL-1 alpha protein (Active) (AB280342)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human IL-1 alpha protein (Active) (AB280342)

SDS-PAGE analysis of ab280342.

HPLC - Recombinant human IL-1 alpha protein (Active) (AB280342)
  • HPLC

Supplier Data

HPLC - Recombinant human IL-1 alpha protein (Active) (AB280342)

HPLC analysis of ab280342.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, HPLC, SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent increase in proliferation of D10.G4.1 cells.

ED50 for this effect is ≤2.51 ng/mL correspondng to a specific activity of 3.98/105 units/mg.

Accession

P01583

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA","proteinLength":"Full Length","predictedMolecularWeight":"18.11 kDa","actualMolecularWeight":"18.11 kDa","aminoAcidEnd":271,"aminoAcidStart":113,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01583","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

Additional notes

=95% Purityby HPLC

General info

Function

Cytokine constitutively present intracellularly in nearly all resting non-hematopoietic cells that plays an important role in inflammation and bridges the innate and adaptive immune systems (PubMed : 26439902). After binding to its receptor IL1R1 together with its accessory protein IL1RAP, forms the high affinity interleukin-1 receptor complex (PubMed : 17507369, PubMed : 2950091). Signaling involves the recruitment of adapter molecules such as MYD88, IRAK1 or IRAK4 (PubMed : 17507369). In turn, mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways (PubMed : 14687581). Within the cell, acts as an alarmin and cell death results in its liberation in the extracellular space after disruption of the cell membrane to induce inflammation and alert the host to injury or damage (PubMed : 15679580). In addition to its role as a danger signal, which occurs when the cytokine is passively released by cell necrosis, directly senses DNA damage and acts as a signal for genotoxic stress without loss of cell integrity (PubMed : 26439902).

Sequence similarities

Belongs to the IL-1 family.

Post-translational modifications

Acetylated within its nuclear localization sequence, which impacts subcellular localization.. Proteolytic processed by CAPN1 in a calcium-dependent manner. Cleavage from 31 kDa precursor to 18 kDa biologically active molecules.. Phosphorylated. Phosphorylation greatly enhances susceptibility to digestion and promotes the conversion of pre-IL1A alpha to the biologically active IL1A.

Product protocols

Target data

Cytokine constitutively present intracellularly in nearly all resting non-hematopoietic cells that plays an important role in inflammation and bridges the innate and adaptive immune systems (PubMed : 26439902). After binding to its receptor IL1R1 together with its accessory protein IL1RAP, forms the high affinity interleukin-1 receptor complex (PubMed : 17507369, PubMed : 2950091). Signaling involves the recruitment of adapter molecules such as MYD88, IRAK1 or IRAK4 (PubMed : 17507369). In turn, mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways (PubMed : 14687581). Within the cell, acts as an alarmin and cell death results in its liberation in the extracellular space after disruption of the cell membrane to induce inflammation and alert the host to injury or damage (PubMed : 15679580). In addition to its role as a danger signal, which occurs when the cytokine is passively released by cell necrosis, directly senses DNA damage and acts as a signal for genotoxic stress without loss of cell integrity (PubMed : 26439902).
See full target information IL1A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com