JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259402

Recombinant human IL-10 protein (Active)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human IL-10 protein (Active) is a Human Fragment protein, in the 26 to 178 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

View Alternative Names

Interleukin-10, IL-10, Cytokine synthesis inhibitory factor, CSIF, IL10

4 Images
Mass Spectrometry - Recombinant human IL-10 protein (Active) (AB259402)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human IL-10 protein (Active) (AB259402)

M+0.17 Da (Calc. mass 17991.83 Da).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60°C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant human IL-10 protein (Active) (AB259402)
  • FuncS

Supplier Data

Functional Studies - Recombinant human IL-10 protein (Active) (AB259402)

Fully biologically active, as determined by dose dependant stimulation of human MC/9 cells.

ED50 is ≤ 3 ng/ mL , corresponding to a specific activity of 3.33 x 105 units/mg.

SDS-PAGE - Recombinant human IL-10 protein (Active) (AB259402)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human IL-10 protein (Active) (AB259402)

SDS-PAGE analysis of ab259402.

HPLC - Recombinant human IL-10 protein (Active) (AB259402)
  • HPLC

Supplier Data

HPLC - Recombinant human IL-10 protein (Active) (AB259402)

Purity = 97%.

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50°C.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Cell Culture, FuncS, HPLC, SDS-PAGE, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active, as determined by dose dependant stimulation of human MC/9 cells.

ED50 is ≤ 3 ng/ mL , corresponding to a specific activity of 3.33 x 105 units/mg.

Accession

P22301

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product will no longer be available once inventory is depleted. It is being replaced by ab284660. This protein has an improved amino acid sequence, 19-178, matching the mature full length IL-10 protein.

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment.

Sequence info

[{"sequence":"SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN","proteinLength":"Fragment","predictedMolecularWeight":"17.99 kDa","actualMolecularWeight":null,"aminoAcidEnd":178,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P22301","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC >=95%.

General info

Function

Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3 (PubMed : 16982608). In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators (PubMed : 18025162). Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF (PubMed : 11564774, PubMed : 1940799, PubMed : 7512027). Also interferes with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation (PubMed : 8144879). In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling (By similarity).

Sequence similarities

Belongs to the IL-10 family.

Product protocols

Target data

Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3 (PubMed : 16982608). In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators (PubMed : 18025162). Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF (PubMed : 11564774, PubMed : 1940799, PubMed : 7512027). Also interferes with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation (PubMed : 8144879). In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling (By similarity).
See full target information IL10

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

iScience 25:105147 PubMed36274932

2022

Vascular restenosis reduction with platelet membrane coated nanoparticle directed M2 macrophage polarization.

Applications

Unspecified application

Species

Unspecified reactive species

Fengshi Li,Zhihua Rong,Rui Zhang,Shuai Niu,Xiao Di,Leng Ni,Changwei Liu
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com