JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259418

Recombinant human IL-12 p70 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human IL-12 p70 protein (Active) is a Human Fragment protein, in the 23 to 219 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

View Alternative Names

NKSF2, IL12B, Interleukin-12 subunit beta, IL-12B, Cytotoxic lymphocyte maturation factor 40 kDa subunit, IL-12 subunit p40, NK cell stimulatory factor chain 2, CLMF p40, NKSF1, IL12A, Interleukin-12 subunit alpha, IL-12A, Cytotoxic lymphocyte maturation factor 35 kDa subunit, IL-12 subunit p35, NK cell stimulatory factor chain 1, CLMF p35

5 Images
Mass Spectrometry - Recombinant human IL-12 p70 protein (Active) (AB259418)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human IL-12 p70 protein (Active) (AB259418)

M + 2.97 Da (Calc mass 34754.03 Da).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Mass Spectrometry - Recombinant human IL-12 p70 protein (Active) (AB259418)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human IL-12 p70 protein (Active) (AB259418)

M + 2.8 Da (Calc. mass 22599.2 Da).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Biological Activity - Recombinant human IL-12 p70 protein (Active) (AB259418)
  • Biological Activity

Lab

Biological Activity - Recombinant human IL-12 p70 protein (Active) (AB259418)

Fully biologically active in a dose-dependent proliferation of NK-92 cell line. ED50 is ≤ 2.35 ng/ml, corresponding to a specific activity of 0.42 x 106 units/mg.

SDS-PAGE - Recombinant human IL-12 p70 protein (Active) (AB259418)
  • SDS-PAGE

Lab

SDS-PAGE - Recombinant human IL-12 p70 protein (Active) (AB259418)

SDS-PAGE analysis of ab259418.

Protein is a heterodimer.

HPLC - Recombinant human IL-12 p70 protein (Active) (AB259418)
  • HPLC

Supplier Data

HPLC - Recombinant human IL-12 p70 protein (Active) (AB259418)

Purity 96%.

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

HPLC, Mass Spec, FuncS, Cell Culture, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active in a dose-dependent proliferation of NK-92 cell line. ED50 is ≤ 2.35 ng/ml, corresponding to a specific activity of 0.42 x 106 units/mg.

Accession

P29460

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment.

IL-12 p70 is a disulfide bonded heterodimer of the IL-12 40 kDa and 35 kDa subunits.

Sequence info

[{"sequence":"RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS","proteinLength":"Fragment","predictedMolecularWeight":"22.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":219,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P29460","tags":[]},{"sequence":"IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS","proteinLength":"Fragment","predictedMolecularWeight":"34.75 kDa","actualMolecularWeight":null,"aminoAcidEnd":328,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P29460","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC >=95%.

General info

Function

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.. Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of pro-inflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.

Sequence similarities

Belongs to the IL-12B family.

Post-translational modifications

Known to be C-mannosylated in the recombinant protein; it is not yet known for sure if the wild-type protein is also modified.

Product protocols

Target data

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.. Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of pro-inflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
See full target information IL12B

Additional targets

IL12A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com