JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259403

Recombinant human IL-15 protein (Active)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human IL-15 protein (Active) is a Human Full Length protein, in the 49 to 162 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for sELISA, SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

View Alternative Names

Interleukin-15, IL-15, IL15

5 Images
Functional Studies - Recombinant human IL-15 protein (Active) (AB259403)
  • FuncS

Supplier Data

Functional Studies - Recombinant human IL-15 protein (Active) (AB259403)

Functional analysis of ab259403.

Fully biologically active determined by the dose dependent proliferation of KHYG-1 cells.

ED50 is ≤1.28 ng/mL, corresponding to a specific activity of 7.8 x 105 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3379485-1

Mass Spectrometry - Recombinant human IL-15 protein (Active) (AB259403)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human IL-15 protein (Active) (AB259403)

Mass determination by ESI-TOF.

Predicted MW is 12830.92 Da (+/- 10 Da by ESI-TOF). Observed MW is 12832.38 Da.

Sandwich ELISA - Recombinant human IL-15 protein (Active) (AB259403)
  • sELISA

Lab

Sandwich ELISA - Recombinant human IL-15 protein (Active) (AB259403)

Background subtracted standard curve using Human IL-15 Antibody Pair - BSA and Azide free (ab241883) and Recombinant human IL-15 protein (Active) (ab259403) in sandwich ELISA.
The ELISA was performed using the components of the corresponding SimpleStep® kit, which uses the same antibody pair with a different formulation and format.

HPLC - Recombinant human IL-15 protein (Active) (AB259403)
  • HPLC

Supplier Data

HPLC - Recombinant human IL-15 protein (Active) (AB259403)

HPLC analysis of ab259403.

SDS-PAGE - Recombinant human IL-15 protein (Active) (AB259403)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human IL-15 protein (Active) (AB259403)

SDS-PAGE analysis of ab259403.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Cell Culture, HPLC, SDS-PAGE, sELISA, Mass Spec, FuncS

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of KHYG-1 cells.

ED50 is ≤1.28 ng/mL, corresponding to a specific activity of 7.8 x 105 units/mg.

Accession

P40933

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "sELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

Sequence info

[{"sequence":"NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS","proteinLength":"Full Length","predictedMolecularWeight":"12.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":162,"aminoAcidStart":49,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P40933","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

Additional notes

>= 95 % HPLC.

General info

Function

Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems (PubMed : 15123770). Stimulates the proliferation of natural killer cells, T-cells and B-cells and promotes the secretion of several cytokines (PubMed : 8178155, PubMed : 9326248). In monocytes, induces the production of IL8 and monocyte chemotactic protein 1/CCL2, two chemokines that attract neutrophils and monocytes respectively to sites of infection (PubMed : 9326248). Unlike most cytokines, which are secreted in soluble form, IL15 is expressed in association with its high affinity IL15RA on the surface of IL15-producing cells and delivers signals to target cells that express IL2RB and IL2RG receptor subunits (PubMed : 10233906, PubMed : 23104097, PubMed : 8026467). Binding to its receptor triggers the phosphorylation of JAK1 and JAK3 and the recruitment and subsequent phosphorylation of signal transducer and activator of transcription-3/STAT3 and STAT5 (PubMed : 7568001). In mast cells, induces the rapid tyrosine phosphorylation of STAT6 and thereby controls mast cell survival and release of cytokines such as IL4 (By similarity).

Sequence similarities

Belongs to the IL-15/IL-21 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems (PubMed : 15123770). Stimulates the proliferation of natural killer cells, T-cells and B-cells and promotes the secretion of several cytokines (PubMed : 8178155, PubMed : 9326248). In monocytes, induces the production of IL8 and monocyte chemotactic protein 1/CCL2, two chemokines that attract neutrophils and monocytes respectively to sites of infection (PubMed : 9326248). Unlike most cytokines, which are secreted in soluble form, IL15 is expressed in association with its high affinity IL15RA on the surface of IL15-producing cells and delivers signals to target cells that express IL2RB and IL2RG receptor subunits (PubMed : 10233906, PubMed : 23104097, PubMed : 8026467). Binding to its receptor triggers the phosphorylation of JAK1 and JAK3 and the recruitment and subsequent phosphorylation of signal transducer and activator of transcription-3/STAT3 and STAT5 (PubMed : 7568001). In mast cells, induces the rapid tyrosine phosphorylation of STAT6 and thereby controls mast cell survival and release of cytokines such as IL4 (By similarity).
See full target information IL15

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

eLife 10: PubMed33522483

2021

Evolutionary transcriptomics implicates in the origins of implantation and regulation of gestation length.

Applications

Unspecified application

Species

Unspecified reactive species

Mirna Marinić,Katelyn Mika,Sravanthi Chigurupati,Vincent J Lynch
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com