JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB9567

Recombinant human IL-17 (IL-17A) protein

Be the first to review this product! Submit a review

|

(4 Publications)

Recombinant human IL-17 (IL-17A) protein is a Human Fragment protein, in the 20 to 155 aa range, expressed in Escherichia coli, with >98%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

CTLA8, IL17, IL17A, Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Assay #1: Measured by its ability to induce IL-6 production by NHDF cells, using a concentration range of 0.5-1.5 ng/ml.

Assay #2: Measured by its ability to induce GROα production by HT-29 cells, using a concentration range of 0.5-5.0 ng/ml.

Accession

Q16552

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in water

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Measured by its ability to induce IL6 production by NHDF cells, using a concentration range of 0.5-1.5 ng/ml.

Sequence info

[{"sequence":"MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA","proteinLength":"Fragment","predictedMolecularWeight":"17 kDa","actualMolecularWeight":null,"aminoAcidEnd":155,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q16552","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Specifications

Form

Lyophilized

Additional notes

Sterile filtered Greater than 98% by SDS-PAGE gel and HPLC analyses.Endotoxin level is less than 0.1 ng per µg (1EU/µg).

General info

Function

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed : 24120361). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation (PubMed : 17911633, PubMed : 18684971, PubMed : 19825828, PubMed : 21350122, PubMed : 24120361, PubMed : 8676080). Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites (By similarity). In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines (By similarity). In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells (By similarity). Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance (By similarity). Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation (By similarity). Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection (PubMed : 21350122). Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis (By similarity). As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release (By similarity). In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers (By similarity). Involved in antiviral host defense through various mechanisms (By similarity). Enhances immunity against West Nile virus by promoting T cell cytotoxicity (By similarity). May play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung (By similarity). Contributes to influenza A virus (H1N1) clearance by driving the differentiation of B-1a B cells, providing for production of virus-specific IgM antibodies at first line of host defense (By similarity).

Sequence similarities

Belongs to the IL-17 family.

Post-translational modifications

N-glycosylated. Found both in glycosylated and nonglycosylated forms.

Product protocols

Target data

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed : 24120361). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation (PubMed : 17911633, PubMed : 18684971, PubMed : 19825828, PubMed : 21350122, PubMed : 24120361, PubMed : 8676080). Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites (By similarity). In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines (By similarity). In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells (By similarity). Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance (By similarity). Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation (By similarity). Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection (PubMed : 21350122). Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis (By similarity). As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release (By similarity). In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers (By similarity). Involved in antiviral host defense through various mechanisms (By similarity). Enhances immunity against West Nile virus by promoting T cell cytotoxicity (By similarity). May play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung (By similarity). Contributes to influenza A virus (H1N1) clearance by driving the differentiation of B-1a B cells, providing for production of virus-specific IgM antibodies at first line of host defense (By similarity).
See full target information IL17A

Publications (4)

Recent publications for all applications. Explore the full list and refine your search

Science signaling 16:eadg1668 PubMed37988454

2023

Enteric glia promote visceral hypersensitivity during inflammation through intercellular signaling with gut nociceptors.

Applications

Unspecified application

Species

Unspecified reactive species

Wilmarie Morales-Soto,Jacques Gonzales,William F Jackson,Brian D Gulbransen

Journal of cellular biochemistry 122:958-968 PubMed31773798

2019

Role of miR-106-mediated mitogen-activated protein kinase signaling pathway in oxidative stress injury and inflammatory infiltration in the liver of the mouse with gestational hypertension.

Applications

Unspecified application

Species

Unspecified reactive species

Zhihui Wang,Xiufang Bao,Limeng Song,Yuying Tian,Ping Sun

Biological research 52:49 PubMed31492195

2019

Astilbin reduces ROS accumulation and VEGF expression through Nrf2 in psoriasis-like skin disease.

Applications

Unspecified application

Species

Unspecified reactive species

Wuyuntana Wang, Yuhai,Huan Wang, Chasuna, Bagenna

International journal of oncology 53:1809-1817 PubMed30066843

2018

Interleukin‑17A and heparanase promote angiogenesis and cell proliferation and invasion in cervical cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Qiongying Lv,Kejia Wu,Fulin Liu,Wanrong Wu,Yurou Chen,Wei Zhang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com