JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259404

Recombinant human IL-3 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human IL-3 protein (Active) is a Human Full Length protein, in the 20 to 152 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

View Alternative Names

Interleukin-3, IL-3, Hematopoietic growth factor, Mast cell growth factor, Multipotential colony-stimulating factor, P-cell-stimulating factor, MCGF, IL3

4 Images
Mass Spectrometry - Recombinant human IL-3 protein (Active) (AB259404)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human IL-3 protein (Active) (AB259404)

M + 2.61 Da (Calc mass 15138.39 Da).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant human IL-3 protein (Active) (AB259404)
  • FuncS

Supplier Data

Functional Studies - Recombinant human IL-3 protein (Active) (AB259404)

Fully active compared to a standard. The ED50 as determined by the dose-dependant proliferation of TF-1 cells is 0.8577 ng/mL corresponding to a Specific Activity of 1.17 x 106 IU/mg.

HPLC - Recombinant human IL-3 protein (Active) (AB259404)
  • HPLC

Supplier Data

HPLC - Recombinant human IL-3 protein (Active) (AB259404)

Purity : 95%.

Sample was deglycosylated prior to HPLC run; the deglycosylation enyzmes account for the second peak.

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

SDS-PAGE - Recombinant human IL-3 protein (Active) (AB259404)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human IL-3 protein (Active) (AB259404)

SDS-PAGE analysis of ab259404.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

HPLC, Mass Spec, FuncS, Cell Culture, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully active compared to a standard. The ED50 as determined by the dose-dependant proliferation of TF-1 cells is 0.8577 ng/mL corresponding to a Specific Activity of 1.17 x 106 IU/mg.

Accession

P08700

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

Sequence info

[{"sequence":"APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF","proteinLength":"Full Length","predictedMolecularWeight":"15.14 kDa","actualMolecularWeight":null,"aminoAcidEnd":152,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P08700","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC >=95%.

General info

Function

Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells (PubMed : 2556442). Also stimulates mature basophils, eosinophils, and monocytes to become functionally activated (PubMed : 10779277, PubMed : 32889153). In addition, plays an important role in neural cell proliferation and survival (PubMed : 23226269). Participates as well in bone homeostasis and inhibits osteoclast differentiation by preventing NF-kappa-B nuclear translocation and activation (PubMed : 12816992). Mechanistically, exerts its biological effects through a receptor composed of IL3RA subunit and a signal transducing subunit IL3RB (PubMed : 29374162). Receptor stimulation results in the rapid activation of JAK2 kinase activity leading to STAT5-mediated transcriptional program (By similarity). Alternatively, contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK (PubMed : 27862234).

Sequence similarities

Belongs to the IL-3 family.

Product protocols

Target data

Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells (PubMed : 2556442). Also stimulates mature basophils, eosinophils, and monocytes to become functionally activated (PubMed : 10779277, PubMed : 32889153). In addition, plays an important role in neural cell proliferation and survival (PubMed : 23226269). Participates as well in bone homeostasis and inhibits osteoclast differentiation by preventing NF-kappa-B nuclear translocation and activation (PubMed : 12816992). Mechanistically, exerts its biological effects through a receptor composed of IL3RA subunit and a signal transducing subunit IL3RB (PubMed : 29374162). Receptor stimulation results in the rapid activation of JAK2 kinase activity leading to STAT5-mediated transcriptional program (By similarity). Alternatively, contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK (PubMed : 27862234).
See full target information IL3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com