JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB281811

Recombinant Human IL-33 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IL-33 protein (Active) is a Human Full Length protein, in the 95 to 270 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for FuncS, SDS-PAGE, Mass Spec, HPLC, Biological Activity, Cell Culture.

View Alternative Names

C9orf26, IL1F11, NFHEV, IL33, Interleukin-33, IL-33, Interleukin-1 family member 11, Nuclear factor from high endothelial venules, IL-1F11, NF-HEV

5 Images
Biological Activity - Recombinant Human IL-33 protein (Active) (AB281811)
  • Biological Activity

Supplier Data

Biological Activity - Recombinant Human IL-33 protein (Active) (AB281811)

Recombinant Human IL-33 protein was determined to be fully biologically active by the dose dependent proliferation of D10S cells. ED50 is ≤ 1.70 ng/ml, corresponding to a specific activity of 5.9 x 10⁵ units/mg.

Cell based assay testing is performed on the first lot of the protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot GR3425563-1.

Mass Spectrometry - Recombinant Human IL-33 protein (Active) (AB281811)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human IL-33 protein (Active) (AB281811)

ESI-TOF analysis of ab281811.

Predicted MW is 19883.29 Da (+/- 10 Da by ESI-TOF). Observed MW is 19884.54 Da.

Biochemical assay - Recombinant Human IL-33 protein (Active) (AB281811)
  • Biochemical assay

Supplier Data

Biochemical assay - Recombinant Human IL-33 protein (Active) (AB281811)

Fully biologically active determined by the dose dependent proliferation of D10S cells. ED50 <= 1.70 ng/ml, corresponding to a specific activity of 5.9x105 units/mg.

SDS-PAGE - Recombinant Human IL-33 protein (Active) (AB281811)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IL-33 protein (Active) (AB281811)

SDS-PAGE analysis of ab281811.

HPLC - Recombinant Human IL-33 protein (Active) (AB281811)
  • HPLC

Supplier Data

HPLC - Recombinant Human IL-33 protein (Active) (AB281811)

HPLC analysis of ab281811.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS, HPLC, Biological Activity, Cell Culture, Mass Spec, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of D10S cells. ED50 is ≤ 1.70 ng/ml, corresponding to a specific activity of 5.9 x 105 units/mg.

Accession

O95760

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Biological Activity": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET","proteinLength":"Full Length","predictedMolecularWeight":"19.88 kDa","actualMolecularWeight":"19.89 kDa","aminoAcidEnd":270,"aminoAcidStart":95,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O95760","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

Additional notes

Purity >=95% by HPLC.

General info

Function

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells (PubMed : 16286016, PubMed : 19841166). Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines (PubMed : 17853410, PubMed : 18836528). Also involved in activation of mast cells, basophils, eosinophils and natural killer cells (PubMed : 17853410, PubMed : 18836528). Acts as an enhancer of polarization of alternatively activated macrophages (PubMed : 19841166). Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury (PubMed : 17853410, PubMed : 18836528). Induces rapid UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages (By similarity).. In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets (PubMed : 21734074). This form is rapidely lost upon angiogenic or pro-inflammatory activation (PubMed : 18787100).

Sequence similarities

Belongs to the IL-1 family. Highly divergent.

Post-translational modifications

The full-length protein can be released from cells and is able to signal via the IL1RL1/ST2 receptor. However, proteolytic processing by CELA1, CSTG/cathepsin G and ELANE/neutrophil elastase produces C-terminal peptides that are more active than the unprocessed full length protein (PubMed:22307629, PubMed:35794369). May also be proteolytically processed by calpains (PubMed:19596270, PubMed:22307629). Proteolytic cleavage mediated by apoptotic caspases including CASP3 and CASP7 results in IL33 inactivation (PubMed:19559631). In vitro proteolytic cleavage by CASP1 was reported (PubMed:16286016, PubMed:19439663) but could not be confirmed in vivo (PubMed:19465481) suggesting that IL33 is probably not a direct substrate for that caspase (PubMed:19439663, PubMed:19465481).

Subcellular localisation

Nucleus

Product protocols

Target data

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells (PubMed : 16286016, PubMed : 19841166). Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines (PubMed : 17853410, PubMed : 18836528). Also involved in activation of mast cells, basophils, eosinophils and natural killer cells (PubMed : 17853410, PubMed : 18836528). Acts as an enhancer of polarization of alternatively activated macrophages (PubMed : 19841166). Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury (PubMed : 17853410, PubMed : 18836528). Induces rapid UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages (By similarity).. In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets (PubMed : 21734074). This form is rapidely lost upon angiogenic or pro-inflammatory activation (PubMed : 18787100).
See full target information IL33

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com