JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB316043

Recombinant Human IL-37 (Active) protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human IL-37 (Active) protein is a Human Fragment protein, in the 27 to 192 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level.

View Alternative Names

FIL1Z, IL1F7, IL1H4, IL1RP1, IL37, Interleukin-37, IL-37, FIL1 zeta, IL-1X, Interleukin-1 family member 7, Interleukin-1 homolog 4, Interleukin-1 zeta, Interleukin-1-related protein, IL-1F7, IL-1H, IL-1H4, IL-1 zeta, IL-1RP1

3 Images
Biological Activity - Recombinant Human IL-37 (Active) protein (AB316043)
  • Biological Activity

Supplier Data

Biological Activity - Recombinant Human IL-37 (Active) protein (AB316043)

Human IL-18BP, hFc Tag captured on CM5 Chip via Protein A can bind Human IL-37, No Tag with an affinity constant of 0.12 μM as determined in SPR assay (Biacore T200).

HPLC - Recombinant Human IL-37 (Active) protein (AB316043)
  • HPLC

Supplier Data

HPLC - Recombinant Human IL-37 (Active) protein (AB316043)

The purity of Human IL-37 is greater than 95% as determined by SEC-HPLC

SDS-PAGE - Recombinant Human IL-37 (Active) protein (AB316043)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IL-37 (Active) protein (AB316043)

Human IL-37 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.

Key facts

Purity

>95% HPLC

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Biologically active

Yes

Biological activity

Human IL-18BP, hFc Tag captured on CM5 Chip via Protein A can bind Human IL-37, No Tag with an affinity constant of 0.12 uM as determined in SPR assay.

Accession

Q9NZH6

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water.

Storage buffer

Constituents: PBS, 8% Trehalose

storage-buffer

Sequence info

[{"sequence":"KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD","proteinLength":"Fragment","predictedMolecularWeight":"18.55 kDa","actualMolecularWeight":null,"aminoAcidEnd":192,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9NZH6","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage duration
A few days
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C|-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IL-37 also known as IL-1F7 is a member of the interleukin 1 cytokine family. This protein has a molecular mass of approximately 25 kDa. IL-37 is mainly expressed in tissues like the kidney thymus testis and uterus with lower levels in the bone marrow and placenta. Researchers identify this protein in various cells such as monocytes which are key players in the immune system.
Biological function summary

IL-37 functions within the immune response by acting as a critical anti-inflammatory cytokine. It does not form a larger complex for its activity but instead interacts directly with various immune cells. IL-37 is capable of reducing pro-inflammatory cytokine production and dampening the immune response when necessary thereby providing a mechanism to prevent excessive inflammation and tissue damage.

Pathways

IL-37 plays a role in pathways like the inflammatory response and immune regulation. Within these systems it interacts with proteins such as IL-18 and IL-18BP (binding protein) which helps modulate its activity. IL-37 can also influence the NF-kB pathway an essential pathway in regulating the immune response by indirectly reducing inflammation.

IL-37 is associated with conditions such as rheumatoid arthritis and inflammatory bowel disease. These disorders involve chronic inflammation where IL-37 might serve a protective role by reducing excessive inflammatory signals. In these contexts IL-37 interacts with other inflammatory cytokines like IL-6 and TNF-α which are known to be elevated in such diseases. By potentially mitigating these signals IL-37 helps in managing the inflammatory aspects of these disorders.

Specifications

Form

Lyophilized

General info

Function

Immune regulatory cytokine that acts as a suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. Signaling can occur via two mechanisms, intracellularly through nuclear translocation with SMAD3 and extracellularly after secretion and binding to its receptor composed of IL18R1 and IL18RAP. Suppresses, or reduces, pro-inflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.

Sequence similarities

Belongs to the IL-1 family.

Post-translational modifications

Proteolytically converted to the mature form by CASP1.

Subcellular localisation

Nucleus

Product protocols

Target data

Immune regulatory cytokine that acts as a suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. Signaling can occur via two mechanisms, intracellularly through nuclear translocation with SMAD3 and extracellularly after secretion and binding to its receptor composed of IL18R1 and IL18RAP. Suppresses, or reduces, pro-inflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.
See full target information IL37

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Diabetology & metabolic syndrome 17:193 PubMed40474280

2025

IL-37 inhibited inflammation to improve gestational diabetes mellitus through the GSK3/NF-κB pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Meiyu Song,Guanli Zhang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com