JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB316086

Recombinant Human IL-6 (Active) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IL-6 (Active) protein is a Human Fragment protein, in the 30 to 212 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level.

View Alternative Names

IFNB2, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, CTL differentiation factor, Hybridoma growth factor, Interferon beta-2, BSF-2, CDF, IFN-beta-2

Key facts

Purity

>95% HPLC

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Biologically active

Yes

Biological activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.1 - 0.5 ng/mL.

Accession

P05231

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water.

Storage buffer

Constituents: 91.99% PBS, 8% Trehalose

storage-buffer

Sequence info

[{"sequence":"VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM","proteinLength":"Fragment","predictedMolecularWeight":"20.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":212,"aminoAcidStart":30,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P05231","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage duration
A few days
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C|-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Interleukin-6 (IL-6) a cytokine also known as IFN-beta2 plays a significant role in immune response and inflammation. The IL-6 protein has a molecular weight of approximately 20-26 kDa. Expression of IL-6 occurs in various cell types including T cells macrophages and fibroblasts. Researchers often measure IL-6 levels in biological samples using IL-6 ELISA kits an essential tool for studying this protein’s function and presence in experimental and clinical settings.
Biological function summary

IL-6 influences immune regulation and acts as part of the acute phase response. It stimulates the production of acute-phase proteins and supports the differentiation of B cells into antibody-producing cells. IL-6 is not known to be part of a larger complex acting primarily as a single entity in signal transduction. Moreover IL-6 impacts the metabolism of iron and bone homeostasis showing its multifunctional nature.

Pathways

IL-6 forms an integral part of several signaling routes particularly the JAK-STAT pathway. In this context IL-6 interacts with signal transducer proteins like STAT3 to transmit signals from the cell surface to the nucleus affecting gene expression. Another important pathway is the MAPK pathway through which IL-6 influences cell proliferation and survival. These interactions reflect IL-6's diverse effects in cellular processes.

IL-6's association with rheumatoid arthritis and multiple myeloma emphasizes its role in chronic inflammation and cancer. In rheumatoid arthritis IL-6 contributes to inflammation and joint damage often together with TNF-alpha highlighting a potential target for anti-inflammatory therapies. In multiple myeloma IL-6 supports the survival and proliferation of cancerous plasma cells highlighting its importance in cancer progression and possible treatment targets.

Specifications

Form

Lyophilized

General info

Function

Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable). The interaction with the membrane-bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6 : IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable).. IL6 is a potent inducer of the acute phase response. Rapid production of IL6 contributes to host defense during infection and tissue injury, but excessive IL6 synthesis is involved in disease pathology. In the innate immune response, is synthesized by myeloid cells, such as macrophages and dendritic cells, upon recognition of pathogens through toll-like receptors (TLRs) at the site of infection or tissue injury (Probable). In the adaptive immune response, is required for the differentiation of B cells into immunoglobulin-secreting cells. Plays a major role in the differentiation of CD4(+) T cell subsets. Essential factor for the development of T follicular helper (Tfh) cells that are required for the induction of germinal-center formation. Required to drive naive CD4(+) T cells to the Th17 lineage. Also required for proliferation of myeloma cells and the survival of plasmablast cells (By similarity).. Acts as an essential factor in bone homeostasis and on vessels directly or indirectly by induction of VEGF, resulting in increased angiogenesis activity and vascular permeability (PubMed : 12794819, PubMed : 17075861). Induces, through 'trans-signaling' and synergistically with IL1B and TNF, the production of VEGF (PubMed : 12794819). Involved in metabolic controls, is discharged into the bloodstream after muscle contraction increasing lipolysis and improving insulin resistance (PubMed : 20823453). 'Trans-signaling' in central nervous system also regulates energy and glucose homeostasis (By similarity). Mediates, through GLP-1, crosstalk between insulin-sensitive tissues, intestinal L cells and pancreatic islets to adapt to changes in insulin demand (By similarity). Also acts as a myokine (Probable). Plays a protective role during liver injury, being required for maintenance of tissue regeneration (By similarity). Also has a pivotal role in iron metabolism by regulating HAMP/hepcidin expression upon inflammation or bacterial infection (PubMed : 15124018). Through activation of IL6ST-YAP-NOTCH pathway, induces inflammation-induced epithelial regeneration (By similarity).

Sequence similarities

Belongs to the IL-6 superfamily.

Post-translational modifications

N- and O-glycosylated.

Product protocols

Target data

Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable). The interaction with the membrane-bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6 : IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable).. IL6 is a potent inducer of the acute phase response. Rapid production of IL6 contributes to host defense during infection and tissue injury, but excessive IL6 synthesis is involved in disease pathology. In the innate immune response, is synthesized by myeloid cells, such as macrophages and dendritic cells, upon recognition of pathogens through toll-like receptors (TLRs) at the site of infection or tissue injury (Probable). In the adaptive immune response, is required for the differentiation of B cells into immunoglobulin-secreting cells. Plays a major role in the differentiation of CD4(+) T cell subsets. Essential factor for the development of T follicular helper (Tfh) cells that are required for the induction of germinal-center formation. Required to drive naive CD4(+) T cells to the Th17 lineage. Also required for proliferation of myeloma cells and the survival of plasmablast cells (By similarity).. Acts as an essential factor in bone homeostasis and on vessels directly or indirectly by induction of VEGF, resulting in increased angiogenesis activity and vascular permeability (PubMed : 12794819, PubMed : 17075861). Induces, through 'trans-signaling' and synergistically with IL1B and TNF, the production of VEGF (PubMed : 12794819). Involved in metabolic controls, is discharged into the bloodstream after muscle contraction increasing lipolysis and improving insulin resistance (PubMed : 20823453). 'Trans-signaling' in central nervous system also regulates energy and glucose homeostasis (By similarity). Mediates, through GLP-1, crosstalk between insulin-sensitive tissues, intestinal L cells and pancreatic islets to adapt to changes in insulin demand (By similarity). Also acts as a myokine (Probable). Plays a protective role during liver injury, being required for maintenance of tissue regeneration (By similarity). Also has a pivotal role in iron metabolism by regulating HAMP/hepcidin expression upon inflammation or bacterial infection (PubMed : 15124018). Through activation of IL6ST-YAP-NOTCH pathway, induces inflammation-induced epithelial regeneration (By similarity).
See full target information IL6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com