JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259381

Recombinant human IL-6 protein (Active)

5

(1 Review)

|

(6 Publications)

Recombinant human IL-6 protein (Active) is a Human Full Length protein, in the 28 to 212 aa range with >=95% purity, < 0.005 EU/µg endotoxin level and suitable for SDS-PAGE, Functinonal studies, ELISA, Cell Culture and more. The predicted molecular weight of ab259381 protein is 21 kDa.

- Save time and ensure accurate results - use our IL-6 protein as a control
- Optimal protein bioactivity, stability and reproducibility
- Available in different sizes to fit your experimental needs

View Alternative Names

IFNB2, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, CTL differentiation factor, Hybridoma growth factor, Interferon beta-2, BSF-2, CDF, IFN-beta-2

8 Images
Functional Studies (Neut/Block) - Recombinant human IL-6 protein (Active) (AB259381)
  • FuncS (Neut/Block)

Supplier Data

Functional Studies (Neut/Block) - Recombinant human IL-6 protein (Active) (AB259381)

Cell proliferation of TF-1 (human erythroleukemia erythroblast) cells treated with IL-6 (ab259381) and anti-IL-6 antibody (ab323372) or isotype IgG (ab210849).​

Cell proliferation (%) (A) confirms that the anti-IL-6 antibody (ab323372) neutralizes IL-6-mediated cell proliferation. The IC50 as determined by the dose-dependent inhibition of TF-1 cells proliferation is 4.990 ng/ml (B). ​

TF-1 cells were seeded at 5 × 10⁴ cells per well in a 96-well plate and cultured in medium containing 5% FBS for 48 h. Proliferation was analysed by luminescent assay and recorded using a Microplate Reader at 560nm emission.

Functional Studies (Neut/Block) - Recombinant human IL-6 protein (Active) (AB259381)
  • FuncS (Neut/Block)

Supplier Data

Functional Studies (Neut/Block) - Recombinant human IL-6 protein (Active) (AB259381)

Cell proliferation of TF-1 (human erythroleukemia erythroblast) cells treated with IL-6 (ab259381) and anti-IL-6 antibody (ab322419) or isotype IgG (ab210849). Cell proliferation (%) (A) confirms that the anti-IL-6 antibody (ab322419) neutralizes IL-6-mediated cell proliferation. The IC50 as determined by the dose-dependent inhibition of TF-1 cells proliferation is 1.450 μg/ml (B). ​ TF-1 cells were seeded at 5 × 10⁴ cells per well in a 96-well plate and cultured in medium containing 5% FBS for 48 h. Luminescence was recorded using a Microplate Reader at 560nm emission. ​

Functional Studies (Neut/Block) - Recombinant human IL-6 protein (Active) (AB259381)
  • FuncS (Neut/Block)

Supplier Data

Functional Studies (Neut/Block) - Recombinant human IL-6 protein (Active) (AB259381)

Cell proliferation of TF-1 (human erythroleukemia erythroblast) cells treated with IL-6 (ab259381) and anti-IL-6R antibody (ab323483) or isotype IgG (ab210849).

Cell proliferation (%) (A) confirms that the anti-IL-6R antibody (ab323483) neutralizes IL-6-mediated cell proliferation. The IC50 as determined by the dose-dependent inhibition of TF-1 cells proliferation is 0.1914 ug/ml (B).

TF-1 cells were plated at a density of 5 × 10⁴ cells per well in a 96-well plate. A dilution series of the anti-IL-6R antibody (ab323483) was added to the cells and pre-incubated for 2 hours before IL-6 (ab259381) stimulation, and cells were cultured in medium with 5% FBS for a duration of 48 hours. Proliferation was analysed by luminescent assay and recorded using a Microplate Reader at 560nm emission.

Sandwich ELISA - Recombinant human IL-6 protein (Active) (AB259381)
  • sELISA

Lab

Sandwich ELISA - Recombinant human IL-6 protein (Active) (AB259381)

Sandwich ELISA - Recombinant human IL-6 protein standard curve.

Background subtracted standard curve using Human IL-6 Antibody Pair - BSA and Azide free (ab243973) and Recombinant human IL-6 protein (Active) (ab259381) in sandwich ELISA. The ELISA was performed using the components of the corresponding SimpleStep® kit, which uses the same antibody pair with a different formulation and format.

Mass Spectrometry - Recombinant human IL-6 protein (Active) (AB259381)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant human IL-6 protein (Active) (AB259381)

M+1 Da, pass (+203 Da : Hex, +203 : HexNAc, +291 : NeuAc).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant human IL-6 protein (Active) (AB259381)
  • FuncS

Lab

Functional Studies - Recombinant human IL-6 protein (Active) (AB259381)

Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of TF-1 cells is 0.8067 ng/mL corresponding to a specific activity of 1.24 x 106 IU/mg.

SDS-PAGE - Recombinant human IL-6 protein (Active) (AB259381)
  • SDS-PAGE

Lab

SDS-PAGE - Recombinant human IL-6 protein (Active) (AB259381)

SDS-PAGE analysis of ab259381.

HPLC - Recombinant human IL-6 protein (Active) (AB259381)
  • HPLC

Lab

HPLC - Recombinant human IL-6 protein (Active) (AB259381)

Purity 99%.

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, SDS-PAGE, sELISA, Cell Culture, FuncS, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of TF-1 cells is 0.8067 ng/mL corresponding to a specific activity of 1.24 x 106 IU/mg.

Accession

P05231

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "sELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our recombinant human IL-6 protein ab259381 as a control.

The ab259381 IL-6 protein is sourced from HEK293 cells and can be used as a positive control in SDS-PAGE, mass spectrometry and HPLC. Analyze your IL-6 ELISA data using the ab259381 protein to generate and plot a standard curve.

Check out our protein gel staining guide for SDS-PAGE here

Check out our ELISA protocol for more information here.

Premium Bioactive Protein range

The ab259381 IL-6 protein is part of the premium bioactive protein range which are ideal for preclinical cell culture and functional studies. These recombinant proteins are of the highest activity, purity, and consistency, meeting rigorous biophysical characterization.

More premium bioactive proteins can be found here.

Sequence info

[{"sequence":"APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM","proteinLength":"Full Length","predictedMolecularWeight":"21.04 kDa","actualMolecularWeight":null,"aminoAcidEnd":212,"aminoAcidStart":28,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P05231","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Interleukin-6 (IL-6) a cytokine also known as IFN-beta2 plays a significant role in immune response and inflammation. The IL-6 protein has a molecular weight of approximately 20-26 kDa. Expression of IL-6 occurs in various cell types including T cells macrophages and fibroblasts. Researchers often measure IL-6 levels in biological samples using IL-6 ELISA kits an essential tool for studying this protein’s function and presence in experimental and clinical settings.
Biological function summary

IL-6 influences immune regulation and acts as part of the acute phase response. It stimulates the production of acute-phase proteins and supports the differentiation of B cells into antibody-producing cells. IL-6 is not known to be part of a larger complex acting primarily as a single entity in signal transduction. Moreover IL-6 impacts the metabolism of iron and bone homeostasis showing its multifunctional nature.

Pathways

IL-6 forms an integral part of several signaling routes particularly the JAK-STAT pathway. In this context IL-6 interacts with signal transducer proteins like STAT3 to transmit signals from the cell surface to the nucleus affecting gene expression. Another important pathway is the MAPK pathway through which IL-6 influences cell proliferation and survival. These interactions reflect IL-6's diverse effects in cellular processes.

IL-6's association with rheumatoid arthritis and multiple myeloma emphasizes its role in chronic inflammation and cancer. In rheumatoid arthritis IL-6 contributes to inflammation and joint damage often together with TNF-alpha highlighting a potential target for anti-inflammatory therapies. In multiple myeloma IL-6 supports the survival and proliferation of cancerous plasma cells highlighting its importance in cancer progression and possible treatment targets.

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC >=95%.

General info

Function

Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable). The interaction with the membrane-bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6 : IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable).. IL6 is a potent inducer of the acute phase response. Rapid production of IL6 contributes to host defense during infection and tissue injury, but excessive IL6 synthesis is involved in disease pathology. In the innate immune response, is synthesized by myeloid cells, such as macrophages and dendritic cells, upon recognition of pathogens through toll-like receptors (TLRs) at the site of infection or tissue injury (Probable). In the adaptive immune response, is required for the differentiation of B cells into immunoglobulin-secreting cells. Plays a major role in the differentiation of CD4(+) T cell subsets. Essential factor for the development of T follicular helper (Tfh) cells that are required for the induction of germinal-center formation. Required to drive naive CD4(+) T cells to the Th17 lineage. Also required for proliferation of myeloma cells and the survival of plasmablast cells (By similarity).. Acts as an essential factor in bone homeostasis and on vessels directly or indirectly by induction of VEGF, resulting in increased angiogenesis activity and vascular permeability (PubMed : 12794819, PubMed : 17075861). Induces, through 'trans-signaling' and synergistically with IL1B and TNF, the production of VEGF (PubMed : 12794819). Involved in metabolic controls, is discharged into the bloodstream after muscle contraction increasing lipolysis and improving insulin resistance (PubMed : 20823453). 'Trans-signaling' in central nervous system also regulates energy and glucose homeostasis (By similarity). Mediates, through GLP-1, crosstalk between insulin-sensitive tissues, intestinal L cells and pancreatic islets to adapt to changes in insulin demand (By similarity). Also acts as a myokine (Probable). Plays a protective role during liver injury, being required for maintenance of tissue regeneration (By similarity). Also has a pivotal role in iron metabolism by regulating HAMP/hepcidin expression upon inflammation or bacterial infection (PubMed : 15124018). Through activation of IL6ST-YAP-NOTCH pathway, induces inflammation-induced epithelial regeneration (By similarity).

Sequence similarities

Belongs to the IL-6 superfamily.

Post-translational modifications

N- and O-glycosylated.

Product protocols

Target data

Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable). The interaction with the membrane-bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6 : IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable).. IL6 is a potent inducer of the acute phase response. Rapid production of IL6 contributes to host defense during infection and tissue injury, but excessive IL6 synthesis is involved in disease pathology. In the innate immune response, is synthesized by myeloid cells, such as macrophages and dendritic cells, upon recognition of pathogens through toll-like receptors (TLRs) at the site of infection or tissue injury (Probable). In the adaptive immune response, is required for the differentiation of B cells into immunoglobulin-secreting cells. Plays a major role in the differentiation of CD4(+) T cell subsets. Essential factor for the development of T follicular helper (Tfh) cells that are required for the induction of germinal-center formation. Required to drive naive CD4(+) T cells to the Th17 lineage. Also required for proliferation of myeloma cells and the survival of plasmablast cells (By similarity).. Acts as an essential factor in bone homeostasis and on vessels directly or indirectly by induction of VEGF, resulting in increased angiogenesis activity and vascular permeability (PubMed : 12794819, PubMed : 17075861). Induces, through 'trans-signaling' and synergistically with IL1B and TNF, the production of VEGF (PubMed : 12794819). Involved in metabolic controls, is discharged into the bloodstream after muscle contraction increasing lipolysis and improving insulin resistance (PubMed : 20823453). 'Trans-signaling' in central nervous system also regulates energy and glucose homeostasis (By similarity). Mediates, through GLP-1, crosstalk between insulin-sensitive tissues, intestinal L cells and pancreatic islets to adapt to changes in insulin demand (By similarity). Also acts as a myokine (Probable). Plays a protective role during liver injury, being required for maintenance of tissue regeneration (By similarity). Also has a pivotal role in iron metabolism by regulating HAMP/hepcidin expression upon inflammation or bacterial infection (PubMed : 15124018). Through activation of IL6ST-YAP-NOTCH pathway, induces inflammation-induced epithelial regeneration (By similarity).
See full target information IL6

Publications (6)

Recent publications for all applications. Explore the full list and refine your search

European journal of immunology 55:e2451351 PubMed40071709

2025

Interferons and Cytokines Induce Transcriptional Activation of the Long-Interspersed Element-1 in Myeloid Cells from Autoimmune Patients.

Applications

Unspecified application

Species

Unspecified reactive species

Ethan Le,Fatemeh Moadab,Xiaoxing Wang,Rayan Najjar,Sadie J Van den Bogaerde,Alison Bays,John LaCava,Tomas Mustelin

iScience 27:111066 PubMed39668865

2024

Self-regulation of MGAT4A and MGAT4B activity toward glycoproteins through interaction of lectin domain with their own -glycans.

Applications

Unspecified application

Species

Unspecified reactive species

Naoko Osada,Sushil K Mishra,Miyako Nakano,Yuko Tokoro,Masamichi Nagae,Robert J Doerksen,Yasuhiko Kizuka

Cells 13: PubMed38667300

2024

Investigating the Impact of IL6 on Insulin Secretion: Evidence from INS-1 Cells, Human Pancreatic Islets, and Serum Analysis.

Applications

Unspecified application

Species

Unspecified reactive species

Jalal Taneera,Anila Khalique,Abdul Khader Mohammed,Bashair M Mussa,Nabil Sulaiman,Eman Abu-Gharbieh,Waseem El-Huneidi,Maha M Saber-Ayad

Nature communications 14:396 PubMed36693849

2023

A natural biological adhesive from snail mucus for wound repair.

Applications

Unspecified application

Species

Unspecified reactive species

Tuo Deng,Dongxiu Gao,Xuemei Song,Zhipeng Zhou,Lixiao Zhou,Maixian Tao,Zexiu Jiang,Lian Yang,Lan Luo,Ankun Zhou,Lin Hu,Hongbo Qin,Mingyi Wu

Journal of experimental & clinical cancer research : CR 41:166 PubMed35513871

2022

Interleukin-6 mediated inflammasome activation promotes oral squamous cell carcinoma progression via JAK2/STAT3/Sox4/NLRP3 signaling pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Li Xiao,Xue Li,Peilin Cao,Wei Fei,Hao Zhou,Na Tang,Yi Liu

Journal of ethnopharmacology 271:113854 PubMed33513419

2021

Potential effect of Maxing Shigan decoction against coronavirus disease 2019 (COVID-19) revealed by network pharmacology and experimental verification.

Applications

Unspecified application

Species

Unspecified reactive species

Yuan Li,Fuhao Chu,Ping Li,Nadia Johnson,Tao Li,Yan Wang,Rongxian An,Dantong Wu,Jiena Chen,Zeqi Su,Xiaohong Gu,Xia Ding
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com