JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB302448

Recombinant Human IL-6R protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IL-6R protein is a Human Fragment protein, in the 20 to 365 aa range, expressed in HEK 293 cells, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

CD126, Interleukin-6 receptor subunit alpha, IL-6 receptor subunit alpha, IL-6R subunit alpha, IL-6R-alpha, IL-6RA, IL-6R 1, Membrane glycoprotein 80, gp80, IL6R

2 Images
SDS-PAGE - Recombinant Human IL-6R protein (AB302448)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IL-6R protein (AB302448)

SDS-page analysis of ab302448

HPLC - Recombinant Human IL-6R protein (AB302448)
  • HPLC

Supplier Data

HPLC - Recombinant Human IL-6R protein (AB302448)

HPLC analysis of ab302448

Key facts

Purity

undefined HPLC

SDS-PAGE >=95%

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

HPLC, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP","proteinLength":"Fragment","predictedMolecularWeight":"38.6 kDa","actualMolecularWeight":"38.6 kDa","aminoAcidEnd":365,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P08887","tags":[]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IL-6R also known as the IL-6 receptor or IL-6R protein is a transmembrane protein with an approximate mass of 80-90 kDa. This receptor is found on the surface of various cells including hepatocytes leukocytes and immune cells like T-cells and macrophages. IL-6R binds to interleukin-6 (IL-6) a cytokine and plays an important role in immune response regulation. The receptor exists in both membrane-bound and soluble forms each contributing to diverse signaling events.
Biological function summary

IL-6 receptor function involves mediating the effects of IL-6 through its interaction with glycoprotein 130 (gp130) forming a signaling complex. This complex initiates intracellular pathways that lead to gene expression changes necessary for immune responses inflammation and hematopoiesis. When IL-6 binds IL-6R the complex formation with gp130 triggers downstream signaling that impacts cell growth differentiation and survival.

Pathways

IL-6R is central to the JAK/STAT signaling pathway one of the two main pathways activated by IL-6 signaling. It's also involved in the MAPK cascade contributing to cellular responses such as proliferation and differentiation. Through these pathways IL-6R interacts with other proteins like JAK kinases and STAT transcription factors coordinating cellular responses to external signals.

IL-6R is associated with inflammatory diseases such as rheumatoid arthritis and certain cancers. In rheumatoid arthritis overexpression of IL-6R leads to persistent inflammation and joint damage. In cancer IL-6/IL-6R signaling promotes tumorigenesis and cancer cell survival through interactions with proteins like STAT3. Understanding these connections aids in developing therapeutic interventions targeting IL-6R in various pathological conditions.

General info

Function

Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal (PubMed : 28265003). Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-phase reactions and hematopoiesis (PubMed : 30995492, PubMed : 31235509). The interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling', the restricted expression of the IL6R limits classic IL6 signaling to only a few tissues such as the liver and some cells of the immune system. Whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6 : IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable).. Isoform 1. Signaling via the membrane-bound IL6R is mostly regenerative and anti-inflammatory (Probable). Drives naive CD4(+) T cells to the Th17 lineage, through 'cluster signaling' by dendritic cells (By similarity).. Isoform 2. Soluble form of IL6 receptor (sIL6R) that acts as an agonist of IL6 activity (PubMed : 21990364). The IL6 : sIL6R complex (hyper-IL6) binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL6R in a process called IL6 'trans-signaling'. sIL6R is causative for the pro-inflammatory properties of IL6 and an important player in the development of chronic inflammatory diseases (PubMed : 21990364). In complex with IL6, is required for induction of VEGF production (PubMed : 12794819). Plays a protective role during liver injury, being required for maintenance of tissue regeneration (By similarity). 'Trans-signaling' in central nervous system regulates energy and glucose homeostasis (By similarity).. Soluble interleukin-6 receptor subunit alpha. Soluble form of IL6 receptor (sIL6R) that acts as an agonist of IL6 activity (PubMed : 21990364). The IL6 : sIL6R complex (hyper-IL6) binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL6R in a process called IL6 'trans-signaling'. sIL6R is causative for the pro-inflammatory properties of IL6 and an important player in the development of chronic inflammatory diseases (PubMed : 21990364). In complex with IL6, is required for induction of VEGF production (PubMed : 12794819). Plays a protective role during liver injury, being required for maintenance of tissue regeneration (By similarity). 'Trans-signaling' in central nervous system regulates energy and glucose homeostasis (By similarity).

Sequence similarities

Belongs to the type I cytokine receptor family. Type 3 subfamily.

Post-translational modifications

A short soluble form is released from the membrane by proteolysis (PubMed:26876177). The sIL6R is formed mostly by limited proteolysis of membrane-bound receptors, a process referred to as ectodomain shedding, but is also directly secreted from the cells after alternative mRNA splicing (PubMed:26876177, PubMed:28060820). mIL6R is cleaved by the proteases ADAM10 and ADAM17 (PubMed:26876177, PubMed:28060820).. Glycosylated. Glycosylation is dispensable for transport, signaling, and cell-surface turnover. Glycosylation at Asn-55 is a protease-regulatory exosite. Glycosylation is required for ADAM17-mediated proteolysis.

Product protocols

Target data

Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal (PubMed : 28265003). Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-phase reactions and hematopoiesis (PubMed : 30995492, PubMed : 31235509). The interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling', the restricted expression of the IL6R limits classic IL6 signaling to only a few tissues such as the liver and some cells of the immune system. Whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6 : IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable).. Isoform 1. Signaling via the membrane-bound IL6R is mostly regenerative and anti-inflammatory (Probable). Drives naive CD4(+) T cells to the Th17 lineage, through 'cluster signaling' by dendritic cells (By similarity).. Isoform 2. Soluble form of IL6 receptor (sIL6R) that acts as an agonist of IL6 activity (PubMed : 21990364). The IL6 : sIL6R complex (hyper-IL6) binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL6R in a process called IL6 'trans-signaling'. sIL6R is causative for the pro-inflammatory properties of IL6 and an important player in the development of chronic inflammatory diseases (PubMed : 21990364). In complex with IL6, is required for induction of VEGF production (PubMed : 12794819). Plays a protective role during liver injury, being required for maintenance of tissue regeneration (By similarity). 'Trans-signaling' in central nervous system regulates energy and glucose homeostasis (By similarity).. Soluble interleukin-6 receptor subunit alpha. Soluble form of IL6 receptor (sIL6R) that acts as an agonist of IL6 activity (PubMed : 21990364). The IL6 : sIL6R complex (hyper-IL6) binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL6R in a process called IL6 'trans-signaling'. sIL6R is causative for the pro-inflammatory properties of IL6 and an important player in the development of chronic inflammatory diseases (PubMed : 21990364). In complex with IL6, is required for induction of VEGF production (PubMed : 12794819). Plays a protective role during liver injury, being required for maintenance of tissue regeneration (By similarity). 'Trans-signaling' in central nervous system regulates energy and glucose homeostasis (By similarity).
See full target information IL6R

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com