JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB316090

Recombinant Human IL-7 (Active) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IL-7 (Active) protein is a Human Fragment protein, in the 26 to 177 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for FuncS.

View Alternative Names

Interleukin-7, IL-7, IL7

Key facts

Purity

>95% HPLC

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS

applications

Biologically active

Yes

Biological activity

Measured in a cell proliferation assay using murine 2E8 cells. The ED50-for this effect is-0.1 - 0.5 ng/mL.

Accession

P13232

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water.

Storage buffer

Constituents: PBS, 8% Trehalose

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH","proteinLength":"Fragment","predictedMolecularWeight":"17.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":177,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P13232","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage duration
A few days
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C|-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Interleukin-7 (IL-7) also known as IL-7 protein or IL-7 is a cytokine with a critical role in immune system development and function. IL-7 has an approximate molecular mass of 25 kDa and it exhibits expression in several tissues including stromal cells in the bone marrow and thymus. It interacts with its specific receptor IL-7R which consists of the IL-7Rα chain and the common gamma chain (γc) shared with other cytokine receptors. These interactions are important for signaling pathways that support lymphoid tissue homeostasis.
Biological function summary

IL-7 significantly influences lymphocyte development and survival. It is essential for the proliferation and maintenance of T cells particularly thymocytes during T cell maturation and peripheral T cells after they exit the thymus. IL-7 does not form a complex itself but works as a critical single molecule in these processes. IL-7's role is especially noted in the maintenance of naïve and memory T cells important for adaptive immunity.

Pathways

IL-7 activity impacts important immune signaling routes. The cytokine is an important player in the JAK/STAT signaling pathway which gets activated upon IL-7R engagement. This pathway is fundamental in controlling T cell development proliferation and survival. IL-7's interaction with other proteins such as the IL-7R complex and their downstream signaling partners integrates it into networks critical for strengthening the immune response.

IL-7 is significantly linked to immunodeficiencies and cancers affecting immune cells. For instance IL-7's altered signaling is associated with severe combined immunodeficiencies (SCID) where the lack of functional IL-7 or its receptor compromises T cell development. Additionally overexpression of IL-7 has connections to certain leukemias and lymphomas where it may contribute to inappropriate lymphocyte proliferation. In these contexts IL-7 often gets investigated alongside proteins such as the JAK and STAT family involved in tumorigenesis and immune dysregulation.

Specifications

Form

Lyophilized

General info

Function

Hematopoietic cytokine that plays an essential role in the development, expansion, and survival of naive and memory T-cells and B-cells thereby regulating the number of mature lymphocytes and maintaining lymphoid homeostasis (PubMed : 25870237, PubMed : 7527823). Mechanistically, exerts its biological effects through a receptor composed of IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG (PubMed : 8128231). Binding to the receptor leads to activation of various kinases including JAK1 or JAK3 depending on the cell type and subsequently propagation of signals through activation of several downstream signaling pathways including the PI3K/Akt/mTOR or the JAK-STAT5 (PubMed : 18523275, PubMed : 20974963).

Sequence similarities

Belongs to the IL-7/IL-9 family.

Product protocols

Target data

Hematopoietic cytokine that plays an essential role in the development, expansion, and survival of naive and memory T-cells and B-cells thereby regulating the number of mature lymphocytes and maintaining lymphoid homeostasis (PubMed : 25870237, PubMed : 7527823). Mechanistically, exerts its biological effects through a receptor composed of IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG (PubMed : 8128231). Binding to the receptor leads to activation of various kinases including JAK1 or JAK3 depending on the cell type and subsequently propagation of signals through activation of several downstream signaling pathways including the PI3K/Akt/mTOR or the JAK-STAT5 (PubMed : 18523275, PubMed : 20974963).
See full target information IL7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com