JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB281790

Recombinant Human IL-8 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IL-8 protein (Active) is a Human Full Length protein, in the 23 to 99 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, HPLC.

View Alternative Names

IL8, CXCL8, Interleukin-8, IL-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1, Monocyte-derived neutrophil chemotactic factor, Monocyte-derived neutrophil-activating peptide, Neutrophil-activating protein 1, Protein 3-10C, T-cell chemotactic factor, GCP-1, MDNCF, MONAP, NAP-1

4 Images
Biological Activity - Recombinant Human IL-8 protein (Active) (AB281790)
  • Biological Activity

Supplier Data

Biological Activity - Recombinant Human IL-8 protein (Active) (AB281790)

Fully biologically active determined by dose dependent induction of cell migration/chemotaxis of BaF3 mouse pro-B cells overexpressing human CXCR2. ED50 is ≤ 8.7 ng/ml, corresponding to a specific activity of 1.15 x 105 units/mg.

Mass Spectrometry - Recombinant Human IL-8 protein (Active) (AB281790)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human IL-8 protein (Active) (AB281790)

Mass determination by ESI-TOF.

Predicted MW is 8979.50 Da. (+/- 10 Da by ESI-TOF). Observes MW is 8980.26 Da.

SDS-PAGE - Recombinant Human IL-8 protein (Active) (AB281790)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IL-8 protein (Active) (AB281790)

SDS-PAGE analysis of ab281790.

HPLC - Recombinant Human IL-8 protein (Active) (AB281790)
  • HPLC

Supplier Data

HPLC - Recombinant Human IL-8 protein (Active) (AB281790)

HPLC analysis of ab281790.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, SDS-PAGE, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by dose dependent induction of cell migration/chemotaxis of BaF3 mouse pro-B cells overexpressing human CXCR2.

ED50 is ≤ 8.7 ng/ml, corresponding to a specific activity of 1.15 x 105 units/mg.

Accession

P10145

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS","proteinLength":"Full Length","predictedMolecularWeight":"8.98 kDa","actualMolecularWeight":null,"aminoAcidEnd":99,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P10145","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IL-8 also known as CXCL8 is a cytokine with a molecular weight of approximately 8 kDa. It belongs to the CXC chemokine family and plays a role in the recruitment of neutrophils to sites of inflammation. Cells like monocytes macrophages and endothelial cells express IL-8 after activation by pro-inflammatory signals. The protein exhibits high expression in cells associated with the immune response and inflammation serving as a signaling molecule between these cell types.
Biological function summary

IL-8 functions as a chemoattractant for neutrophils and lymphocytes facilitating their movement towards the site of infection or injury. It does not form part of a larger protein complex but operates individually to enhance immune cell migration. IL-8 possesses unique binding motifs allowing it to interact with specific receptors namely CXCR1 and CXCR2 on target cells. This binding triggers cellular responses leading to effective immune surveillance and response to inflammatory stimuli.

Pathways

IL-8 operates within important inflammatory and immune response pathways. It forms a part of the NF-κB signaling cascade which activates in response to stress signals promoting the expression of other inflammatory mediators. Additionally it engages in the mitogen-activated protein kinase (MAPK) pathway influencing cellular responses such as proliferation and differentiation. The interaction of IL-8 with these pathways highlights its role in modulating immune responses and highlights its interaction with other proteins such as TNF-α and IL-1β.

IL-8 shows a strong association with conditions like rheumatoid arthritis and chronic obstructive pulmonary disease (COPD). It acts as a biomarker for these diseases often correlating with disease severity and inflammation levels. In rheumatoid arthritis IL-8 contributes to joint inflammation and degradation while in COPD it enhances airway inflammation and tissue damage. The cytokine's involvement in these diseases connects it with other inflammatory mediators such as MMPs and leukotrienes which collectively exacerbate disease pathology.

Specifications

Form

Lyophilized

Additional notes

>=95% Purity by HPLC

General info

Function

Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection (PubMed : 18692776, PubMed : 7636208). Also plays an important role in neutrophil activation (PubMed : 2145175, PubMed : 9623510). Released in response to an inflammatory stimulus, exerts its effect by binding to the G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes and endothelial cells (PubMed : 1840701, PubMed : 1891716). G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptor and activation by IL8 leads to beta and gamma subunits release from Galpha (GNAI2 in neutrophils) and activation of several downstream signaling pathways including PI3K and MAPK pathways (PubMed : 11971003, PubMed : 8662698).

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Post-translational modifications

Several N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form.. Citrullination at Arg-27 prevents proteolysis, and dampens tissue inflammation, it also enhances leukocytosis, possibly through impaired chemokine clearance from the blood circulation.. (Microbial infection) Cleaved by group A Streptococcus protease SpyCEP; leading to impaired neutrophil endothelial transmigration and thus increased virulence.

Product protocols

Target data

Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection (PubMed : 18692776, PubMed : 7636208). Also plays an important role in neutrophil activation (PubMed : 2145175, PubMed : 9623510). Released in response to an inflammatory stimulus, exerts its effect by binding to the G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes and endothelial cells (PubMed : 1840701, PubMed : 1891716). G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptor and activation by IL8 leads to beta and gamma subunits release from Galpha (GNAI2 in neutrophils) and activation of several downstream signaling pathways including PI3K and MAPK pathways (PubMed : 11971003, PubMed : 8662698).
See full target information CXCL8

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com