JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB165762

Recombinant Human IL28RA protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IL28RA protein (GST tag N-Terminus) is a Human Fragment protein, in the 51 to 150 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

IL28RA, LICR2, IFNLR1, Interferon lambda receptor 1, IFN-lambda receptor 1, IFN-lambda-R1, Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, Interleukin-28 receptor subunit alpha, Likely interleukin or cytokine receptor 2, CRF2-12, IL-28 receptor subunit alpha, IL-28R-alpha, IL-28RA

1 Images
SDS-PAGE - Recombinant Human IL28RA protein (GST tag N-Terminus) (AB165762)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human IL28RA protein (GST tag N-Terminus) (AB165762)

ab165762 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q8IU57

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as IL-28 Receptor alpha.

Sequence info

[{"sequence":"QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPC","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":150,"aminoAcidStart":51,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q8IU57","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IL28RA also known as Interleukin-28 receptor alpha or IFNLR1 is a cytokine receptor subunit with a molecular mass of roughly 57 kDa. This protein is part of the class II cytokine receptor family and is expressed predominantly in epithelial cells but also found in liver tissues and certain immune cells. IL28RA forms a receptor complex with IL10RB facilitating signaling through binding with type III interferons such as IFN-λ1 IFN-λ2 and IFN-λ3.
Biological function summary

IL28RA plays an important role in mediating antiviral responses and regulating immune processes. As part of a heterodimeric receptor complex IL28RA along with IL10RB responds to type III interferons. These interactions trigger Jak-STAT signaling pathways which contribute to the transcriptional activation of interferon-stimulated genes (ISGs). The induction of these ISGs provides an important immune defense by inhibiting viral replication and modulating the immune response.

Pathways

IL28RA's function connects to the Jak-STAT signaling pathway and the innate immune response. In the Jak-STAT pathway IL28RA collaborates with IL10RB to activate STAT proteins and facilitate immune signaling. This pathway's activity is integral for maintaining antiviral defense mechanisms and modulating immune responses against pathogens. Through this pathway IL28RA links to other proteins such as STAT1 and STAT2 which play important roles in signal transduction.

Studies implicate IL28RA in conditions like chronic hepatitis C and autoimmune diseases. The role of IL28RA in immune modulation suggests its involvement in the pathogenesis of these conditions. In chronic hepatitis C IL28RA interacts with type III interferons influencing viral clearance and treatment responses. Furthermore in autoimmune disorders aberrant IL28RA signaling may contribute to dysregulated immune responses. Its interaction with IL10RB and subsequent signaling events could impact disease progression and therapeutic outcomes.

Specifications

Form

Liquid

General info

Function

The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium.

Sequence similarities

Belongs to the type II cytokine receptor family.

Post-translational modifications

Ubiquitinated by FBXO45-containing E3 ligase leading to proteasomal degradation.

Product protocols

Target data

The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium.
See full target information IFNLR1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com