JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB243775

Recombinant human IL36 alpha/IL-1F6 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human IL36 alpha/IL-1F6 protein (Active) is a Human Full Length protein, in the 1 to 158 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, HPLC.

View Alternative Names

FIL1E, IL1E, IL1F6, IL36A, Interleukin-36 alpha, FIL1 epsilon, Interleukin-1 epsilon, Interleukin-1 family member 6, IL-1 epsilon, IL-1F6

1 Images
SDS-PAGE - Recombinant human IL36 alpha/IL-1F6 protein (Active) (AB243775)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human IL36 alpha/IL-1F6 protein (Active) (AB243775)

SDS Page analysis of IL-36 alpha/IL-1F6 with ab243775.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

HPLC, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rHuIL-36α at 1 μg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 μg/mL.

Accession

Q9UHA7

Animal free

No

Carrier free

Yes

Species

Human

Reconstitution

Reconstitute in water or 0.1% BSA aqueous buffer

Storage buffer

Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF","proteinLength":"Full Length","predictedMolecularWeight":"17.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":158,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UHA7","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IL-36 alpha also known as IL-1F6 is a member of the IL-1 cytokine family and has a molecular mass of approximately 18 kDa. It is mostly expressed in epithelial tissues like the skin and lungs where it plays a role in the immune response. This protein acts as a pro-inflammatory mediator by binding to the IL-36 receptor stimulating the production of various cytokines and promoting inflammation.
Biological function summary

IL-36 alpha is involved in the activation of immune cells including macrophages and keratinocytes which further boosts the inflammatory response. It is not part of a larger complex but interacts with specific receptors on cell surfaces to exert its functions. This cytokine is known to enhance the expression of other inflammatory mediators which can amplify immune responses in the local tissue environment.

Pathways

IL-36 alpha takes part in the IL-1 signaling pathway and the NF-kB signaling pathway which are important for the regulation of immune and inflammatory responses. Through these pathways IL-36 alpha interacts with other proteins including IL-36 receptor antagonists and IL-37 to manage inflammation and regulate immune cell behavior. These pathways help in coordinating defense mechanisms under inflammatory conditions.

IL-36 alpha has been linked to psoriasis and inflammatory bowel disease conditions that arise due to dysregulated immune responses. IL-36 alpha interacts with other proteins like IL-17 and TNF-alpha which are also involved in the pathophysiology of these diseases. Understanding its role in these processes may offer insights into potential therapeutic targets for treating such inflammatory disorders.

Specifications

Form

Lyophilized

Additional notes

>95% as determined by HPLC.

General info

Function

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of pro-inflammatory cytokines such as TNF-alpha, IL-8 and IL-6. In cultured monocytes up-regulates expression of IL-1A, IL-1B and IL-6. In myeloid dendritic cells involved in cell maturation by up-regulating surface expression of CD83, CD86 and HLA-DR. In monocyte-derived dendritic cells facilitates dendritic cell maturation and drives T-cell proliferation. May play a role in pro-inflammatory effects in the lung.

Sequence similarities

Belongs to the IL-1 family.

Post-translational modifications

N-terminal truncation leads to a dramatic enhancement of its activity (>1000-fold).

Product protocols

Target data

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of pro-inflammatory cytokines such as TNF-alpha, IL-8 and IL-6. In cultured monocytes up-regulates expression of IL-1A, IL-1B and IL-6. In myeloid dendritic cells involved in cell maturation by up-regulating surface expression of CD83, CD86 and HLA-DR. In monocyte-derived dendritic cells facilitates dendritic cell maturation and drives T-cell proliferation. May play a role in pro-inflammatory effects in the lung.
See full target information IL36A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com