JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167874

Recombinant Human IL36 gamma/IL-1F9 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IL36 gamma/IL-1F9 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 169 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

IL1E, IL1F9, IL1H1, IL1RP2, UNQ2456/PRO5737, IL36G, Interleukin-36 gamma, IL-1-related protein 2, Interleukin-1 epsilon, Interleukin-1 family member 9, Interleukin-1 homolog 1, IL-1RP2, IL-1 epsilon, IL-1F9, IL-1H1

1 Images
SDS-PAGE - Recombinant Human IL36 gamma/IL-1F9 protein (His tag N-Terminus) (AB167874)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human IL36 gamma/IL-1F9 protein (His tag N-Terminus) (AB167874)

15% SDS-PAGE analysis of ab167874 (3µg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9NZH8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris-HCl buffer

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as IL36 gamma.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND","proteinLength":"Full Length","predictedMolecularWeight":"21.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":169,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9NZH8","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IL36 gamma also known as IL-1F9 or IL-36 is a member of the interleukin-1 cytokine family. The protein weighs approximately 22 kDa. It is expressed highly in epithelial tissues such as keratinocytes in the skin bronchial tissues and intestinal lining. It acts mainly on nearby cells to influence immune responses through cytokine signaling.
Biological function summary

IL36 gamma plays a role in the immune and inflammatory responses. It operates as a cytokine that signals through the IL-1 receptor family leading to the activation of NF-kB and MAPK pathways. This member of the IL-1 family does not form a complex by itself but interacts with IL-36R to exert its functions. The protein influences processes such as cell proliferation differentiation and the regulation of immune responses to external pathogens or injuries.

Pathways

IL36 gamma is involved in inflammatory and immune signaling pathways. Within the immune response pathway it stimulates the production of other cytokines and pro-inflammatory molecules. IL36 gamma is associated with the IL-1 signaling pathway alongside other cytokines such as IL-1 and IL-18 which all contribute to immune modulation and inflammatory responses.

IL36 gamma has connections to psoriasis and inflammatory bowel disease. In psoriasis increased levels of IL36 gamma correlate with heightened skin inflammation and proliferation of keratinocytes. In inflammatory bowel disease IL36 gamma contributes to the inflammatory state of the gut. The activities of IL36 gamma often link with other cytokines such as TNF-alpha which collectively drive the inflammatory processes observed in these conditions.

Specifications

Form

Liquid

Additional notes

purified by using conventional chromatography techniques.

General info

Function

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous pro-inflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in pro-inflammatory responses during particular neutrophilic airway inflammation : activates mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts, and stimulates the expression of IL-8 and CXCL3 and Th17 chemokine CCL20 in lung fibroblasts. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus.

Sequence similarities

Belongs to the IL-1 family.

Post-translational modifications

N-terminal truncation leads to a dramatic enhancement of its activity (>1000-fold) (PubMed:21965679). Proteolytically cleaved by cathepsin CTSG (PubMed:30804664).

Product protocols

Target data

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous pro-inflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in pro-inflammatory responses during particular neutrophilic airway inflammation : activates mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts, and stimulates the expression of IL-8 and CXCL3 and Th17 chemokine CCL20 in lung fibroblasts. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus.
See full target information IL36G

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com