JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276297

Recombinant Human Inhibin beta E chain protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Inhibin beta E chain protein (Fc Chimera) is a Human Full Length protein, in the 237 to 350 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Inhibin beta E chain, Activin beta-E chain, INHBE

1 Images
SDS-PAGE - Recombinant Human Inhibin beta E chain protein (Fc Chimera) (AB276297)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Inhibin beta E chain protein (Fc Chimera) (AB276297)

SDS-PAGE analysis of ab276297

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P58166

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS","proteinLength":"Full Length","predictedMolecularWeight":"40.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":350,"aminoAcidStart":237,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P58166","tags":[{"tag":"Fc","terminus":"N-Terminus"}]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Inhibin beta E chain also known as 'INHBE' is a protein with multiple roles in the human body weighing about 42 kDa. It is a member of the transforming growth factor-beta (TGF-β) superfamily. The protein can be expressed in many tissues including the liver and placenta. INHBE is associated with other proteins to form different complexes affecting various biological processes.
Biological function summary

The Inhibin beta E chain participates in the regulation of reproductive hormone activity. It forms either homodimers or heterodimers combining with other inhibin and activin molecules. The dimerization with alpha chains forms inhibins while pairing with other beta subunits forms activins. These complexes then modulate signaling pathways that adjust hormonal secretion particularly in the pituitary and gonadal tissues.

Pathways

Inhibin beta E chain plays a significant role in the activin signaling pathway. This pathway affects the regulation of FSH (follicle-stimulating hormone) secretion which is important for reproductive processes. INHBE relates to proteins such as follistatin and activin A within these pathways influencing activities flowing from ligand-receptor interactions to transcriptional regulation.

Inhibin beta E chain has been linked to certain reproductive and metabolic disorders. For instance abnormal expression or dysfunction of INHBE may relate to polycystic ovary syndrome (PCOS) affecting women’s fertility. Liver diseases such as non-alcoholic fatty liver disease (NAFLD) also show associations with INHBE levels. In these contexts INHBE interacts with various TGF-β family proteins contributing to either disease progression or regulation.

General info

Function

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.. Activin E is a homodimer of INHBE secreted by the liver that plays a crucial role in regulating metabolic homeostasis particularly in lipid metabolism and energy homeostasis. Plays a central role in the regulation of adipose tissue lipolysis by preventing the influx of fatty acids from adipose tissue into the liver. Mechanistically, signals via ACVR1C to activate SMAD2/3 signaling, suppressing PPARG target genes in adipose tissue, thereby reducing liver lipid content and improving glycemic control (PubMed : 38533769). Induces beige adipocyte formation and thermogenesis in response to cold exposure (By similarity).

Sequence similarities

Belongs to the TGF-beta family.

Product protocols

Target data

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.. Activin E is a homodimer of INHBE secreted by the liver that plays a crucial role in regulating metabolic homeostasis particularly in lipid metabolism and energy homeostasis. Plays a central role in the regulation of adipose tissue lipolysis by preventing the influx of fatty acids from adipose tissue into the liver. Mechanistically, signals via ACVR1C to activate SMAD2/3 signaling, suppressing PPARG target genes in adipose tissue, thereby reducing liver lipid content and improving glycemic control (PubMed : 38533769). Induces beige adipocyte formation and thermogenesis in response to cold exposure (By similarity).
See full target information INHBE

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com