JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB289767

Recombinant Human Insig2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Insig2 protein is a Human Full Length protein, in the 1 to 225 aa range, expressed in Cell free, with >85%, suitable for SDS-PAGE.

View Alternative Names

Insulin-induced gene 2 protein, INSIG-2, INSIG2

1 Images
SDS-PAGE - Recombinant Human Insig2 protein (AB289767)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Insig2 protein (AB289767)

SDS-PAGE analysis of ab289767

Key facts

Purity

>85% SDS-PAGE

Expression system

Cell free

Tags

10x His tag N-Terminus Myc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9Y5U4

Animal free

Yes

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 - 8 Constituents: 6% Trehalose, 0.87% Sodium chloride, 0.24% Tris, 0.05% 2-Octadecoxyethanol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE","proteinLength":"Full Length","predictedMolecularWeight":"32.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":225,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Cell free","accessionNumber":"Q9Y5U4","tags":[{"tag":"10x His","terminus":"N-Terminus"},{"tag":"Myc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Insig2 short for Insulin Induced Gene 2 is a protein that plays an important role in lipid metabolism regulation. It has a mass of approximately 29 kDa and is also known as INSIG-2 and SREBP-inhibiting protein 2. This protein is embedded in the endoplasmic reticulum membrane and its expression occurs in tissues such as the liver adipose tissue and the brain. Insig2 functions as a regulatory protein binding to other proteins and controlling their activities related to cholesterol and fatty acid synthesis.
Biological function summary

The Insig2 protein serves as an integral component in the regulation of lipid homeostasis. It participates in a protein complex including sterol regulatory element-binding proteins (SREBPs) and SCAP acting as an anchor to retain the SREBP-SCAP complex in the endoplasmic reticulum. By stopping the complex from being transported to the Golgi Insig2 prevents the activation of SREBPs which reduces cholesterol synthesis in cells. Insig2's role in maintaining lipid levels is significant in balancing energy metabolism.

Pathways

Insig2 is directly involved in the cholesterol biosynthesis pathway and the fatty acid metabolism pathway. In these pathways Insig2 works alongside proteins such as SCAP and SREBPs halting SREBPs' transport and activation when cellular sterol levels are high. This regulation plays a critical role in ensuring lipid levels remain in balance emphasizing Insig2's importance in the response to sterol changes within the cell.

Insig2 shows an association with metabolic disorders like obesity and type 2 diabetes. Variations in the Insig2 gene may affect the regulation of lipid metabolism contributing to these conditions. Insig2 also interacts with SREBPs in this context as any disturbance in the Insig2-SREBPs regulatory mechanism can disturb normal lipid processing leading to metabolic dysregulation associated with these diseases.

Specifications

Form

Lyophilized

General info

Function

Oxysterol-binding protein that mediates feedback control of cholesterol synthesis by controlling both endoplasmic reticulum to Golgi transport of SCAP and degradation of HMGCR (PubMed : 12242332, PubMed : 16606821, PubMed : 32322062). Acts as a negative regulator of cholesterol biosynthesis by mediating the retention of the SCAP-SREBP complex in the endoplasmic reticulum, thereby blocking the processing of sterol regulatory element-binding proteins (SREBPs) SREBF1/SREBP1 and SREBF2/SREBP2 (PubMed : 32322062). Binds oxysterol, including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol and 27-hydroxycholesterol, regulating interaction with SCAP and retention of the SCAP-SREBP complex in the endoplasmic reticulum (PubMed : 17428920, PubMed : 26160948, PubMed : 32322062). In presence of oxysterol, interacts with SCAP, retaining the SCAP-SREBP complex in the endoplasmic reticulum, thereby preventing SCAP from escorting SREBF1/SREBP1 and SREBF2/SREBP2 to the Golgi (PubMed : 32322062). Sterol deprivation or phosphorylation by PCK1 reduce oxysterol-binding, disrupting the interaction between INSIG2 and SCAP, thereby promoting Golgi transport of the SCAP-SREBP complex, followed by processing and nuclear translocation of SREBF1/SREBP1 and SREBF2/SREBP2 (PubMed : 32322062). Also regulates cholesterol synthesis by regulating degradation of HMGCR : initiates the sterol-mediated ubiquitin-mediated endoplasmic reticulum-associated degradation (ERAD) of HMGCR via recruitment of the reductase to the ubiquitin ligase RNF139 (PubMed : 16606821, PubMed : 22143767).

Sequence similarities

Belongs to the INSIG family.

Post-translational modifications

Phosphorylation at Ser-151 by PCK1 reduces binding to oxysterol, disrupting the interaction between INSIG2 and SCAP, thereby promoting nuclear translocation of SREBP proteins (SREBF1/SREBP1 or SREBF2/SREBP2) and subsequent transcription of downstream lipogenesis-related genes.. Polyubiquitinated by AMFR/gp78 at Cys-215 in some tissues such as adipose tissues, undifferentiated myoblasts and liver, leading to its degradation (PubMed:31953408). In differentiated myotubes, Cys-215 oxidation prevents ubiquitination at the same site, resulting in protein stabilization (PubMed:31953408).. Oxidized at Cys-215 in differentiated myotubes, preventing ubiquitination at the same site, and resulting in protein stabilization.

Product protocols

Target data

Oxysterol-binding protein that mediates feedback control of cholesterol synthesis by controlling both endoplasmic reticulum to Golgi transport of SCAP and degradation of HMGCR (PubMed : 12242332, PubMed : 16606821, PubMed : 32322062). Acts as a negative regulator of cholesterol biosynthesis by mediating the retention of the SCAP-SREBP complex in the endoplasmic reticulum, thereby blocking the processing of sterol regulatory element-binding proteins (SREBPs) SREBF1/SREBP1 and SREBF2/SREBP2 (PubMed : 32322062). Binds oxysterol, including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol and 27-hydroxycholesterol, regulating interaction with SCAP and retention of the SCAP-SREBP complex in the endoplasmic reticulum (PubMed : 17428920, PubMed : 26160948, PubMed : 32322062). In presence of oxysterol, interacts with SCAP, retaining the SCAP-SREBP complex in the endoplasmic reticulum, thereby preventing SCAP from escorting SREBF1/SREBP1 and SREBF2/SREBP2 to the Golgi (PubMed : 32322062). Sterol deprivation or phosphorylation by PCK1 reduce oxysterol-binding, disrupting the interaction between INSIG2 and SCAP, thereby promoting Golgi transport of the SCAP-SREBP complex, followed by processing and nuclear translocation of SREBF1/SREBP1 and SREBF2/SREBP2 (PubMed : 32322062). Also regulates cholesterol synthesis by regulating degradation of HMGCR : initiates the sterol-mediated ubiquitin-mediated endoplasmic reticulum-associated degradation (ERAD) of HMGCR via recruitment of the reductase to the ubiquitin ligase RNF139 (PubMed : 16606821, PubMed : 22143767).
See full target information Insulin-induced gene 2 protein

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com